Description

  • Product name

    Recombinant Human TRAR4 protein
  • Expression system

    Wheat germ
  • Protein length

    Full length protein
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      MSSNSSLLVAVQLCYANVNGSCVKIPFSPGSRVILYIVFGFGAVLAVFGN LLVMISILHFKQLHSPTNFLVASLACADFLVGVTVMPFSMVRTVESCWYF GRSFCTFHTCCDVAFCYSSLFHLCFISIDRYIAVTDPLVYPTKFTVSVSG ICISVSWILPLMYSGAVFYTGVYDDGLEELSDALNCIGGCQTVVNQNWVL TDFLSFFIPTFIMIILYGNIFLVARRQAKKIENTGSKTESSSESYKARVA RRERKAAKTLGVTVVAFMISWLPYSIDSLIDAFMGFITPACIYEICCWCA YYNSAMNPLIYALFYPWFRKAIKVIVTGQVLKNSSATMNLFSEHI
    • Amino acids

      1 to 345
    • Tags

      GST tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab166238 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form

    Liquid
  • Additional notes

    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names

    • SCZD5
    • Ta4
    • Taar6
    • TAAR6_HUMAN
    • TaR 4
    • TaR-4
    • TaR-6
    • TaR4
    • Trace amine associated receptor 6
    • Trace amine receptor 4
    • Trace amine receptor 6
    • Trace amine-associated receptor 6
    • TRAR4
    see all
  • Function

    Orphan receptor. Could be a receptor for trace amines. Trace amines are biogenic amines present in very low levels in mammalian tissues. Although some trace amines have clearly defined roles as neurotransmitters in invertebrates, the extent to which they function as true neurotransmitters in vertebrates has remained speculative. Trace amines are likely to be involved in a variety of physiological functions that have yet to be fully understood.
  • Tissue specificity

    Expressed at low abundance in various brain tissues, as well as in fetal liver, but not in the cerebellum or placenta. In the brain, comparable levels of expression in basal ganglia, frontal cortex, substantia nigra, amygdala and hippocampus, highest expression in hippocampus and lowest expression in basal ganglia.
  • Sequence similarities

    Belongs to the G-protein coupled receptor 1 family.
  • Cellular localization

    Cell membrane.
  • Information by UniProt

Images

  • ab166238 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab166238 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab166238.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up