Overview

  • Product name

    Recombinant Human TRC40 protein
  • Protein length

    Full length protein

Description

  • Nature

    Recombinant
  • Source

    Escherichia coli
  • Amino Acid Sequence
    • Accession
    • Species

      Human
    • Sequence

      MGSSHHHHHHSSGLVPRGSHMGSMAAGVAGWGVEAEEFEDAPDVEPLEPT LSNIIEQRSLKWIFVGGKGGVGKTTCSCSLAVQLSKGRESVLIISTDPAH NISDAFDQKFSKVPTKVKGYDNLFAMEIDPSLGVAELPDEFFEEDNMLSM GKKMMQEAMSAFPGIDEAMSYAEVMRLVKGMNFSVVVFDTAPTGHTLRLL NFPTIVERGLGRLMQIKNQISPFISQMCNMLGLGDMNADQLASKLEETLP VIRSVSEQFKDPEQTTFICVCIAEFLSLYETERLIQELAKCKIDTHNIIV NQLVFPDPEKPCKMCEARHKIQAKYLDQMEDLYEDFHIVKLPLLPHEVRG ADKVNTFSALLLEPYKPPSAQ
    • Molecular weight

      41 kDa including tags
    • Amino acids

      1 to 348
    • Tags

      His tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab134590 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    Mass Spectrometry

  • Mass spectrometry

    MALDI-TOF
  • Purity

    > 90 % SDS-PAGE.
    ab134590 is purified using conventional chromatography techniques.
  • Form

    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    pH: 8.00
    Constituents: 0.32% Tris HCl, 10% Glycerol

General Info

  • Alternative names

    • ARSA
    • ARSA 1
    • ArsA arsenite transporter ATP binding homolog 1
    • ArsA arsenite transporter, ATP binding, E. coli, homolog of, 1
    • ArsA arsenite transporter, ATP-binding, homolog 1 (bacterial)
    • ARSA I
    • ARSA-I
    • ARSA1
    • ARSAI
    • Arsenical pump driving ATPase
    • Arsenical pump-driving ATPase
    • Arsenical resistance ATPase
    • Arsenite translocating ATPase
    • Arsenite transporting ATPase
    • Arsenite-stimulated ATPase
    • ASNA 1
    • ASNA I
    • ASNA-I
    • ASNA_HUMAN
    • ASNA1
    • Asna1 protein
    • ASNAI
    • ATPase ASNA1
    • GET3
    • Golgi to ER traffic 3 homolog
    • hARSA-I
    • hASNA-I
    • MGC3821
    • Transmembrane domain recognition complex 40 kDa ATPase subunit
    • Transmembrane domain recognition complex, 40kDa
    • TRC40
    see all
  • Function

    ATPase required for the post-translational delivery of tail-anchored (TA) proteins to the endoplasmic reticulum. Recognizes and selectively binds the transmembrane domain of TA proteins in the cytosol. This complex then targets to the endoplasmic reticulum by membrane-bound receptors, where the tail-anchored protein is released for insertion. This process is regulated by ATP binding and hydrolysis. ATP binding drives the homodimer towards the closed dimer state, facilitating recognition of newly synthesized TA membrane proteins. ATP hydrolysis is required for insertion. Subsequently, the homodimer reverts towards the open dimer state, lowering its affinity for the membrane-bound receptor, and returning it to the cytosol to initiate a new round of targeting (By similarity). May be involved in insulin signaling.
  • Tissue specificity

    Expressed in the epithelial cells of the liver, kidney, and stomach wall, in the adrenal medulla, in the islet cells of the pancreas, in the red pulp of the spleen, and in cardiac and skeletal muscle.
  • Sequence similarities

    Belongs to the arsA ATPase family.
  • Cellular localization

    Cytoplasm. Endoplasmic reticulum. Nucleus > nucleolus.
  • Information by UniProt

Images

  • 15% SDS-PAGE analysis of 3 µg ab134590

References

ab134590 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab134590.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up