Overview

Description

  • Nature

    Recombinant
  • Source

    Wheat germ
  • Amino Acid Sequence
    • Species

      Human
    • Sequence

      MAAVGPPQQQVRMAHQQVWAALEVALRVPCLYIIDAIFNSYPDSSQSRFC IVLQIFLRLFGVFASSIVLILSQRSLFKFYTYSSAFLLAATSVLVNYYAS LHIDFYGAYNTSAFGIELLPRKGPSLWMALIVLQLTFGIGYVTLLQIHSI YSQLIILDLLVPVIGLITELPLHIRETLLFTSSLILTLNTVFVLAVKLKW FYYSTRYVYLLVRHMYRIYGLQLLMEDTWKRIRFPDILRVFWLTRVTAQA TVLMYILRMANETDSFFISWDDFWDLICNLIISGCDSTLTVLGMSAVISS VAHYLGLGILAFIGSTEEDDRRLGFVAPVLFFILALQTGLSGLRPEERLI RLSRNMCLLLTAVLHFIHGMTDPVLMSLSASHVSSFRRHFPVLFVSACLF ILPVLLSYVLWHHYALNTWLFAVTAFCVELCLKVIVSLTVYTLFMIDGYY NVLWEKLDDYVYYVRSTGSIIEFIFGVVMFGNGAYTMMFESGSKIRAFMM CLHAYFNIYLQAKNGWKTFMNRRTAVKKINSLPEIKGSRLQEINDVCAIC YHEFTTSARITPCNHYFHALCLRKWLYIQDTCPMCHQKVYIEDDIKDNSN VSNNNGFIPPNETPEEAVREAAAESDRELNEDDSTDCDDDVQRERNGVIQ HTGAAAEEFNDDTD
    • Amino acids

      1 to 664
    • Tags

      GST tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab161365 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form

    Liquid
  • Additional notes

    Protein concentration is above or equal to 0.05 mg/ml.

     This product was previously labelled as RNF139

     

  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names

    • E3 ubiquitin-protein ligase RNF139
    • HRCA1
    • RCA1
    • Ring finger protein 139
    • Translocation in renal carcinoma on chromosome 8 protein
    • TRC8
    see all
  • Relevance

    RNF139 is a multi-membrane spanning protein E3 ubiquitin ligase which is mutated in clear-cell renal carcinomas. It contains a sterol-sensing domain and a RING-H2 motif essential for ubiquitin ligase activity. It is a potential tumor suppressor for renal cell carcinoma. Human kidney cells are growth inhibited by RNF139. Inhibition is manifested by G2/M arrest and is dependent upon the ubiquitin ligase activity of the RING domain. Expression of RNF139 represses genes involved in cholesterol and fatty acid biosynthesis that are transcriptionally regulated by the sterol response element binding proteins (SREBPs). RNF139 modulation of SREBP activity comprises a novel regulatory link between growth control and the cholesterol/lipid homeostasis pathway.
  • Cellular localization

    Endoplasmic reticulum membrane; Multi-pass membrane protein.

Images

  • ab161365 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab161365 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab161365.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up