Description

  • Product name

    Recombinant Human TREML2 protein
  • Purity

    > 95 % SDS-PAGE.
    Purity greater than 95% as determined by SEC-HPLC and reducing SDS-PAGE.
  • Endotoxin level

    < 1.000 Eu/µg
  • Expression system

    HEK 293 cells
  • Accession

  • Protein length

    Protein fragment
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      GPSADSVYTKVRLLEGETLSVQCSYKGYKNRVEGKVWCKIRKKKCEPGFA RVWVKGPRYLLQDDAQAKVVNITMVALKLQDSGRYWCMRNTSGILYPLMG FQLDVSPAPQSERNIPFTHLDNILKSGTVTTGQAPTSGPDAPFTTGVMVF TPGLITLPRLLASTRPASKTGYSFTATSTTSQGPRRTMGSQTVTASPSNA RDSSAGPESISTKSGDLSTRSPTTGLCLTSRSLLNRLPSMPSIRHQDVYS VDDIEGRMDEPKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRT PEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVL TVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSRE EMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFL YSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK
    • Predicted molecular weight

      54 kDa including tags
    • Amino acids

      19 to 268
    • Additional sequence information

      Extracellular domain fused with a FC tag at the C-terminus.

Specifications

Our Abpromise guarantee covers the use of ab191918 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    HPLC

    SDS-PAGE

  • Form

    Lyophilised
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. The lyophilized protein is stable for a few weeks at room temperature. Store at -80°C. Avoid freeze / thaw cycle.

    pH: 7.40
    Constituent: 100% PBS

    Lyophilized from a 0.2 µM filtered solution.

General Info

  • Alternative names

    • C6orf76
    • Chromosome 6 open reading frame 76
    • FLJ13693
    • MGC149715
    • MGC149716
    • TLT 2
    • TLT2
    • TREM like transcript 2
    • Trem like transcript 2 protein
    • Triggering receptor expressed on myeloid cells like 2
    • Triggering receptor expressed on myeloid cells like protein 2
    see all
  • Relevance

    TREML2 is a single-pass type I membrane protein, and it contains 1 Ig-like V-type (immunoglobulin-like) domain. It is a cell surface receptor that may play a role in the innate and adaptive immune response. TREML2 is located in a gene cluster on chromosome 6 with the single Ig variable (IgV) domain activating receptors TREM1 and TREM2, but it has distinct structural and functional properties. TREML2 is expressed throughout B cell development in addition to being expressed on macrophages and neutrophils and is the only TREM molecule to be found on lymphocytes. TREML2 is expressed on B lineage cells early in development, and the highest level of expression is detected on those mature peripheral B cell subpopulations that are involved in the initial humoral immune response against bacterial pathogens. TREML2 is unique in that it lacks either the conserved transmembrane lysine residue or ITAM/ITIMs within its own cytoplasmic domain. Thus, TREML2 does not exhibit any of the features associated with classical tyrosine-based signaling. Monocytes in the bone marrow or peripheral blood do not express detectable levels of TREML2, but its expression is up-regulated in conjunction with differentiation into macrophages. TREML2 is present on neutrophils in the bone marrow as well as the periphery, and inflammatory stimuli result in a dramatic increase in the expression of TREML2 on these cells in vivo.
  • Cellular localization

    Cell membrane; Single-pass type I membrane protein.

References

ab191918 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab191918.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up