Overview

  • Product name

    Recombinant Human TREX1 protein
  • Protein length

    Full length protein

Description

  • Nature

    Recombinant
  • Source

    Wheat germ
  • Amino Acid Sequence
    • Species

      Human
    • Sequence

      MQTLIFFDMEATGLPFSQPKVTELCLLAVHRCALESPPTSQGPPPTVPPP PRVVDKLSLCVAPGKACSPAASEITGLSTAVLAAHGRQCFDDNLANLLLA FLRRQPQPWCLVAHNGDRYDFPLLQAELAMLGLTSALDGAFCVDSITALK ALERASSPSEHGPRKSYSLGSIYTRLYGQSPPDSHTAEGDVLALLSICQW RPQALLRWVDAHARPFGTIRPMYGVTASARTKPRPSAVTTTAHLATTRNT SPSLRESRGTKDLPPVKDPGALSREGLLAPLGLLAILTLAVATLYGLSLA TPGE
    • Amino acids

      1 to 304
    • Tags

      GST tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab161394 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form

    Liquid
  • Additional notes

    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names

    • 3' 5' exonuclease TREX1
    • 3' repair exonuclease 1
    • AGS1
    • AGS5
    • CRV
    • Deoxyribonuclease III, dnaQ/mutD (E. coli) like
    • DKFZp434J0310
    • DNase III
    • DRN3
    • HERNS
    • Three prime repair exonuclease 1
    • TREX1
    see all
  • Relevance

    TREX1 is the major 3'->5' DNA exonuclease in human cells. The protein is a non processive exonuclease that may serve a proofreading function for a human DNA polymerase. It is also a component of the SET complex, and acts to rapidly degrade 3' ends of nicked DNA during granzyme A mediated cell death. Mutations in this gene result in Aicardi Goutieres syndrome, chilblain lupus, and Cree encephalitis. Multiple transcript variants encoding different isoforms have been found for this gene.
  • Cellular localization

    Nuclear

Images

  • ab161394 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab161394 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab161394.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up