Overview

Description

  • Nature
    Recombinant
  • Source
    Escherichia coli
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      MGSSHHHHHHSSGLVPRGSHMSEAPRAETFVFLDLEATGLPSVEPEIAEL SLFAVHRSSLENPEHDESGALVLPRVLDKLTLCMCPERPFTAKASEIT GL SSEGLARCRKAGFDGAVVRTLQAFLSRQAGPICLVAHNGFDYDFPL LCAE LRRLGARLPRDTVCLDTLPALRGLDRAHSHGTRARGRQGYSLGS LFHRYF RAEPSAAHSAEGDVHTLLLIFLHRAAELLAWADEQARGWAHI EPMYLPPD DPSLEA
    • Molecular weight
      28 kDa including tags
    • Amino acids
      1 to 236
    • Tags
      His tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab104641 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    Mass Spectrometry

  • Mass spectrometry
    MALDI-TOF
  • Purity
    > 95 % SDS-PAGE.
    purified by using anion-exchange chromatography (DEAE sepharose resin) and gel-filtration chromatography (Sephacryl S-200) with 20mM Tris pH 7.5, 2mM EDTA.
  • Form
    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Upon delivery aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.077% DTT, 0.316% Tris HCl, 30% Glycerol, 1.16% Sodium chloride

General Info

  • Alternative names
    • 3' 5' exonuclease
    • 3' 5' exonuclease TREX2
    • 3'-5' exonuclease TREX2
    • Three prime repair exonuclease 2
    • TREX 2
    • TREX2
    • TREX2_HUMAN
    see all
  • Function
    Exonuclease with a preference for double-stranded DNA with mismatched 3' termini. May play a role in DNA repair.
  • Tissue specificity
    Detected in heart, breast, prostate, skeletal muscle, testis, uterus, bone marrow, colon, small intestine, stomach and thymus.
  • Sequence similarities
    Belongs to the exonuclease superfamily. TREX family.
  • Cellular localization
    Nucleus.
  • Information by UniProt

Images

  • 15% SDS-PAGE showing ab104641 at approximately 28kDa (3µg).

References

ab104641 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab104641.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up