Overview

  • Product name

    Recombinant Human TRF2 protein
  • Protein length

    Full length protein

Description

  • Nature

    Recombinant
  • Source

    Wheat germ
  • Amino Acid Sequence
    • Accession
    • Species

      Human
    • Sequence

      MAGGGGSSDGSGRAAGRRASRSSGRARRGRHEPGLGGPAERGAGEARLEE AVNRWVLKFYFHEALRAFRGSRYGDFRQIRDIMQALLVRPLGKEHTVSRL LRVMQCLSRIEEGENLDCSFDMEAELTPLESAINVLEMIKTEFTLTEAVV ESSRKLVKEAAVIICIKNKEFEKASKILKKHMSKDPTTQKLRNDLLNIIR EKNLAHPVIQNFSYETFQQKMLRFLESHLDDAEPYLLTVRLGPSPITMVC P
    • Molecular weight

      55 kDa including tags
    • Amino acids

      1 to 251

Specifications

Our Abpromise guarantee covers the use of ab152737 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

    SDS-PAGE

  • Form

    Liquid
  • Additional notes

    Protein concentration is above or equal to 0.05 µg/µl.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names

    • Telomeric DNA binding protein
    • Telomeric DNA-binding protein
    • Telomeric repeat binding factor 2
    • Telomeric repeat binding protein 2
    • Telomeric repeat-binding factor 2
    • TERF 2
    • Terf2
    • TERF2_HUMAN
    • TRBF 2
    • TRBF2
    • TRF 2
    • TRF2
    • TTAGGG repeat binding factor 2
    • TTAGGG repeat-binding factor 2
    see all
  • Function

    Binds the telomeric double-stranded 5'-TTAGGG-3' repeat and plays a central role in telomere maintenance and protection against end-to-end fusion of chromosomes. In addition to its telomeric DNA-binding role, required to recruit a number of factors and enzymes required for telomere protection, including the shelterin complex, TERF2IP/RAP1 and DCLRE1B/Apollo. Component of the shelterin complex (telosome) that is involved in the regulation of telomere length and protection. Shelterin associates with arrays of double-stranded 5'-TTAGGG-3' repeats added by telomerase and protects chromosome ends; without its protective activity, telomeres are no longer hidden from the DNA damage surveillance and chromosome ends are inappropriately processed by DNA repair pathways. Together with DCLRE1B/Apollo, plays a key role in telomeric loop (T loop) formation by generating 3' single-stranded overhang at the leading end telomeres: T loops have been proposed to protect chromosome ends from degradation and repair. Required both to recruit DCLRE1B/Apollo to telomeres and activate the exonuclease activity of DCLRE1B/Apollo. Preferentially binds to positive supercoiled DNA. Together with DCLRE1B/Apollo, required to control the amount of DNA topoisomerase (TOP1, TOP2A and TOP2B) needed for telomere replication during fork passage and prevent aberrant telomere topology. Recruits TERF2IP/RAP1 to telomeres, thereby participating in to repressing homology-directed repair (HDR), which can affect telomere length.
  • Tissue specificity

    Ubiquitous. Highly expressed in spleen, thymus, prostate, uterus, testis, small intestine, colon and peripheral blood leukocytes.
  • Sequence similarities

    Contains 1 HTH myb-type DNA-binding domain.
  • Domain

    The TRFH dimerization region mediates the interaction with DCLRE1B/Apollo but not TINF2.
  • Post-translational
    modifications

    Phosphorylated upon DNA damage, probably by ATM or ATR.
  • Cellular localization

    Nucleus. Chromosome > telomere. Colocalizes with telomeric DNA in interphase cells and is located at chromosome ends during metaphase.
  • Information by UniProt

Images

  • 12.5% SDS-PAGE analysis of ab152737 stained with Coomassie Blue.

References

This product has been referenced in:

  • Su CH  et al. An H2A Histone Isotype, H2ac, Associates with Telomere and Maintains Telomere Integrity. PLoS One 11:e0156378 (2016). WB . Read more (PubMed: 27228173) »
See 1 Publication for this product

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab152737.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up