Overview

  • Product name

    Recombinant Human TRFP/MED20 protein
  • Protein length

    Full length protein

Description

  • Nature

    Recombinant
  • Source

    Escherichia coli
  • Amino Acid Sequence
    • Accession
    • Species

      Human
    • Sequence

      MGSSHHHHHHSSGLVPRGSHMGSMGVTCVSQMPVAEGKSVQQTVELLTRK LEMLGAEKQGTFCVDCETYHTAASTLGSQGQTGKLMYVMHNSEYPLSCFA LFENGPCLIADTNFDVLMVKLKGFFQSAKASKIETRGTRYQYCDFLVKVG TVTMGPSARGISVEVEYGPCVVASDCWSLLLEFLQSFLGSHTPGAPAVFG NRHDAVYGPADTMVQYMELFNKIRKQQQVPVAGIR
    • Molecular weight

      25 kDa including tags
    • Amino acids

      1 to 212
    • Tags

      His tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab139245 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    Mass Spectrometry

  • Mass spectrometry

    MALDI-TOF
  • Purity

    > 90 % SDS-PAGE.
    ab139245 is purified using conventional chromatography techniques.
  • Form

    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    pH: 8.50
    Constituents: 0.02% DTT, 0.32% Tris HCl, 50% Glycerol, 1.17% Sodium chloride

General Info

  • Alternative names

    • MED20
    • Mediator complex subunit 20
    • TRF proximal protein homolog
    • TRFP
  • Relevance

    TRFP / MED20 is a member of the mediator complex that can act as both a positive and negative regulator of transcription. The mediator complex interacts with RNA pol II and its associated proteins, the general transcription factors. Mediator proteins serve as a bridge connecting the activator and basal transcription machinery.
  • Cellular localization

    Nucleus

Images

  • 15% SDS-PAGE analysis of 3 µg ab139245.

References

ab139245 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab139245.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up