Description

  • Product name

    Recombinant Human TRIB1 protein
  • Purity

    > 95 % SDS-PAGE.

  • Expression system

    Baculovirus infected Sf9 cells
  • Accession

  • Protein length

    Full length protein
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      MRVGPVRSAMSGASQPRGPALLFPATRGVPAKRLLDADDAAAVAAKCPRL SECSSPPDYLSPPGSPCSPQPPPAAPGAGGGSGSAPGPSRIADYLLLPLA EREHVSRALCIHTGRELRCKVFPIKHYQDKIRPYIQLPSHSNITGIVEVI LGETKAYVFFEKDFGDMHSYVRSRKRLREEEAARLFKQIVSAVAHCHQSA IVLGDLKLRKFVFSTEERTQLRLESLEDTHIMKGEDDALSDKHGCPAYVS PEILNTTGTYSGKAADVWSLGVMLYTLLVGRYPFHDSDPSALFSKIRRGQ FCIPEHISPKARCLIRSLLRREPSERLTAPEILLHPWFESVLEPGYIDSE IGTSDQIVPEYQEDSDISSFFC
    • Predicted molecular weight

      70 kDa including tags
    • Amino acids

      1 to 372
    • Tags

      proprietary tag N-Terminus

Associated products

Specifications

Our Abpromise guarantee covers the use of ab186079 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    SDS-PAGE

  • Form

    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on Dry Ice. Upon delivery aliquot. Store at -80°C. Avoid freeze / thaw cycle.

    pH: 7.50
    Constituents: 25% Glycerol, 0.88% Sodium chloride, 0.79% Tris HCl, 0.31% Glutathione, 0.003% EDTA, 0.004% DTT, 0.002% PMSF

General Info

  • Alternative names

    • C8FW
    • G-protein-coupled receptor-induced gene 2 protein
    • GIG-2
    • GIG2
    • SKIP1
    • TRB-1
    • TRB1
    • Trib1
    • TRIB1_HUMAN
    • Tribbles homolog 1
    see all
  • Function

    Interacts with MAPK kinases and regulates activation of MAP kinases. May not display kinase activity.
  • Tissue specificity

    Expressed in most human tissues with the highest levels in skeletal muscle, thyroid gland, pancreas, peripheral blood leukocytes, and bone marrow.
  • Sequence similarities

    Belongs to the protein kinase superfamily. CAMK Ser/Thr protein kinase family. Tribbles subfamily.
    Contains 1 protein kinase domain.
  • Domain

    The protein kinase domain is predicted to be catalytically inactive.
  • Information by UniProt

Images

  • SDS-PAGE of ab186079.

References

ab186079 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab186079.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up