Description

  • Product name

    Recombinant Human TRIB2 protein
  • Purity

    > 90 % SDS-PAGE.
    Assessed by densitometry
  • Expression system

    Baculovirus infected Sf9 cells
  • Accession

  • Protein length

    Full length protein
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      MNIHRSTPITIARYGRSRNKTQDFEELSSIRSAEPSQSFSPNLGSPSPPE TPNLSHCVSC IGKYLLLEPLEGDHVFRAVHLHSGEELVCKVFDISCYQ ESLAPCFCLSAHSNINQITEII LGETKAYVFFERSYGDMHSFVRTCKK LREEEAARLFYQIASAVAHCHDGGLVLRDLKLRK FIFKDEERTRVKLE SLEDAYILRGDDDSLSDKHGCPAYVSPEILNTSGSYSGKAADVWSL GV MLYTMLVGRYPFHDIEPSSLFSKIRRGQFNIPETLSPKAKCLIRSILRRE PSERLTSQ EILDHPWFSTDFSVSNSAYGAKEVSDQLVPDVNMEENLDP FFN
    • Predicted molecular weight

      64 kDa including tags
    • Amino acids

      1 to 343
    • Tags

      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab186094 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    Western blot

  • Form

    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on Dry Ice. Upon delivery aliquot. Store at -80°C. Avoid freeze / thaw cycle.

    pH: 7.5
    Constituents: 0.79% Tris HCl, 0.88% Sodium chloride, 0.31% Glutathione, 25% Glycerol, 0.003% EDTA, 0.004% DTT, 0.002% PMSF

General Info

  • Alternative names

    • C5FW
    • FLJ57420
    • GS3955
    • Hypothetical protein TRB2
    • TRB-2
    • TRB2
    • TRIB 2
    • TRIB2
    • TRIB2_HUMAN
    • Tribbles homolog 2
    see all
  • Function

    Interacts with MAPK kinases and regulates activation of MAP kinases. Does not display kinase activity.
  • Tissue specificity

    Highly expressed in peripheral blood leukocytes.
  • Sequence similarities

    Belongs to the protein kinase superfamily. CAMK Ser/Thr protein kinase family. Tribbles subfamily.
    Contains 1 protein kinase domain.
  • Cellular localization

    Cytoplasm. Cytoplasm > cytoskeleton. May associate with the cytoskeleton.
  • Information by UniProt

Images

  • SDS Page analysis of ab186094

References

ab186094 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab186094.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up