Description

  • Product name

    Recombinant Human TRIB3 protein (denatured)
    See all TRIB3 proteins and peptides
  • Purity

    > 85 % SDS-PAGE.
    ab202154 was purified by conventional chromatography techniques.
  • Expression system

    Escherichia coli
  • Accession

  • Protein length

    Full length protein
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      MGSSHHHHHHSSGLVPRGSHMGSMRATPLAAPAGSLSRKKRLELDDNLDT ERPVQKRARSGPQPRLPPCLLPLSPPTAPDRATAVATASRLGPYVLLEPE EGGRAYQALHCPTGTEYTCKVYPVQEALAVLEPYARLPPHKHVARPTEVL AGTQLLYAFFTRTHGDMHSLVRSRHRIPEPEAAVLFRQMATALAHCHQHG LVLRDLKLCRFVFADRERKKLVLENLEDSCVLTGPDDSLWDKHACPAYVG PEILSSRASYSGKAADVWSLGVALFTMLAGHYPFQDSEPVLLFGKIRRGA YALPAGLSAPARCLVRCLLRREPAERLTATGILLHPWLRQDPMPLAPTRS HLWEAAQVVPDGLGLDEAREEEGDREVVLYG
    • Predicted molecular weight

      42 kDa including tags
    • Amino acids

      1 to 358
    • Tags

      His tag N-Terminus
    • Additional sequence information

      NP_066981.
  • Description

    Recombinant Human TRIB3 protein

Specifications

Our Abpromise guarantee covers the use of ab202154 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

  • Form

    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    pH: 8
    Constituents: 0.32% Tris HCl, 10% Glycerol

General Info

  • Alternative names

    • C20orf97
    • Neuronal cell death inducible putative kinase
    • Neuronal cell death-inducible putative kinase
    • NIPK
    • p65 interacting inhibitor of NF-kappaB
    • p65-interacting inhibitor of NF-kappa-B
    • SINK
    • SKIP 3
    • SKIP3
    • TRB 3
    • TRB-3
    • TRB3
    • TRIB 3
    • Trib3
    • TRIB3_HUMAN
    • Tribbles homolog 3
    • Tribbles pseudokinase 3
    • Tribbles3
    see all
  • Function

    Disrupts insulin signaling by binding directly to Akt kinases and blocking their activation. May bind directly to and mask the 'Thr-308' phosphorylation site in AKT1. Binds to ATF4 and inhibits its transcriptional activation activity. Interacts with the NF-kappa-B transactivator p65 RELA and inhibits its phosphorylation and thus its transcriptional activation activity. Interacts with MAPK kinases and regulates activation of MAP kinases. May play a role in programmed neuronal cell death but does not appear to affect non-neuronal cells. Does not display kinase activity.
  • Tissue specificity

    Highest expression in liver, pancreas, peripheral blood leukocytes and bone marrow. Also highly expressed in a number of primary lung, colon and breast tumors. Expressed in spleen, thymus, and prostate and is undetectable in other examined tissues, including testis, ovary, small intestine, colon, leukocyte, heart, brain, placenta, lung, skeletal muscle, and kidney.
  • Sequence similarities

    Belongs to the protein kinase superfamily. CAMK Ser/Thr protein kinase family. Tribbles subfamily.
    Contains 1 protein kinase domain.
  • Cellular localization

    Nucleus.
  • Information by UniProt

Images

  • 15% SDS-PAGE analysis of ab202154 (3µg).

References

ab202154 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab202154.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up