Overview

  • Product name

    Recombinant Human TRIC-B protein
  • Protein length

    Full length protein

Description

  • Nature

    Recombinant
  • Source

    Wheat germ
  • Amino Acid Sequence
    • Species

      Human
    • Sequence

      MDSPWDELALAFSRTSMFPFFDIAHYLVSVMAVKRQPGAAALAWKNPISS WFTAMLHCFGGGILSCLLLAEPPLKFLANHTNILLASSIWYITFFCPHDL VSQGYSYLPVQLLASGMKEVTRTWKIVGGVTHANSYYKNGWIVMIAIGWA RGAGGTIITNFERLVKGDWKPEGDEWLKMSYPAKVTLLGSVIFTFQHTQH LAISKHNLMFLYTIFIVATKITMMTTQTSTMTFAPFEDTLSWMLFGWQQP FSSCEKKSEAKSPSNGVGSLASKPVDVASDNVKKKHTKKNE
    • Amino acids

      1 to 291
    • Tags

      GST tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab162985 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form

    Liquid
  • Additional notes

    Protein concentration is above or equal to 0.05 mg/ml.

    Previously labelled as TMEM38B.

  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names

    • bA219P18.1
    • C9orf87
    • D4Ertd89e
    • FLJ10493
    • OTTHUMP00000021849
    • OTTHUMP00000063855
    • RP11-219P18.1
    • TM38B_HUMAN
    • TMEM38B
    • Transmembrane protein 38B
    • TRIC B
    • TRIC-B
    • TRICB
    • Trimeric intracellular cation channel type B
    see all
  • Function

    Monovalent cation channel required for maintenance of rapid intracellular calcium release. May act as a potassium counter-ion channel that functions in synchronization with calcium release from intracellular stores.
  • Sequence similarities

    Belongs to the TMEM38 family.
  • Domain

    The second transmembrane domain has been proposed to cross only half of the lipid bilayer and to loop back into the cytosol, so that the domains on each side of this domain are both found on the cytosolic face of the membrane. The cytosolic loop may form an ion-conducting pore.
  • Cellular localization

    Endoplasmic reticulum membrane.
  • Information by UniProt

Images

  • ab162985 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab162985 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab162985.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up