Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      AEDLKAKLEKSLEHLRKQMQDALLFQAQADETCVLWQKMVESQRQNVLGE FERLRRLLAEEEQQLLQRLEEEELEVLPRLREGAAHLGQQSAHLAELIA
    • Amino acids
      132 to 230
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab164338 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • BIA 1
    • BIA1
    • E3 ubiquitin protein ligase TRIM11
    • E3 ubiquitin-protein ligase TRIM11
    • Protein BIA1
    • RING finger protein 92
    • RING type E3 ubiquitin transferase TRIM11
    • RNF 92
    • RNF92
    • TRI11_HUMAN
    • Trim 11
    • TRIM11
    • Tripartite motif containing 11
    • tripartite motif protein 11
    • Tripartite motif-containing protein 11
    see all
  • Function
    E3 ubiquitin-protein ligase that promotes the degradation of insoluble ubiquitinated proteins, including insoluble PAX6, poly-Gln repeat expanded HTT and poly-Ala repeat expanded ARX. Mediates PAX6 ubiquitination leading to proteasomal degradation, thereby modulating cortical neurogenesis. May also inhibit PAX6 transcriptional activity, possibly in part by preventing the binding of PAX6 to its consensus sequences. May contribute to the regulation of the intracellular level of HN (humanin) or HN-containing proteins through the proteasomal degradation pathway. Mediates MED15 ubiquitination leading to proteasomal degradation. May contribute to the innate restriction of retroviruses. Upon overexpression, reduces HIV-1 and murine leukemia virus infectivity, by suppressing viral gene expression. Antiviral activity depends on a functional E3 ubiquitin-protein ligase domain. May regulate TRIM5 turnover via the proteasome pathway, thus counteracting the TRIM5-mediated cross-species restriction of retroviral infection at early stages of the retroviral life cycle.
  • Tissue specificity
    Ubiquitous.
  • Pathway
    Protein modification; protein ubiquitination.
  • Sequence similarities
    Belongs to the TRIM/RBCC family.
    Contains 1 B box-type zinc finger.
    Contains 1 B30.2/SPRY domain.
    Contains 1 RING-type zinc finger.
  • Domain
    The coiled-coil domain and the B30.2 domain are both necessary for interaction with HN and PAX6 (By similarity). They are also involved in MED15-binding.
    The B30.2 domain may be involved cellular protein quality control by promoting the degradation of insoluble ubiquitinated proteins.
  • Cellular localization
    Cytoplasm. Nucleus.
  • Information by UniProt

Images

  • ab164338 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab164338 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab164338.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up