Recombinant Human TRIM11 protein (ab164338)
- Datasheet
- References
- Protocols
Description
-
Product name
Recombinant Human TRIM11 protein -
Expression system
Wheat germ -
Protein length
Protein fragment -
Animal free
No -
Nature
Recombinant -
-
Species
Human -
Sequence
AEDLKAKLEKSLEHLRKQMQDALLFQAQADETCVLWQKMVESQRQNVLGE FERLRRLLAEEEQQLLQRLEEEELEVLPRLREGAAHLGQQSAHLAELIA -
Amino acids
132 to 230 -
Tags
GST tag N-Terminus
-
Specifications
Our Abpromise guarantee covers the use of ab164338 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
-
Applications
Western blot
ELISA
-
Form
Liquid -
Additional notes
Protein concentration is above or equal to 0.05 mg/ml. -
Concentration information loading...
Preparation and Storage
-
Stability and Storage
Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.
pH: 8.00
Constituents: 0.31% Glutathione, 0.79% Tris HCl
General Info
-
Alternative names
- BIA 1
- BIA1
- E3 ubiquitin protein ligase TRIM11
see all -
Function
E3 ubiquitin-protein ligase that promotes the degradation of insoluble ubiquitinated proteins, including insoluble PAX6, poly-Gln repeat expanded HTT and poly-Ala repeat expanded ARX. Mediates PAX6 ubiquitination leading to proteasomal degradation, thereby modulating cortical neurogenesis. May also inhibit PAX6 transcriptional activity, possibly in part by preventing the binding of PAX6 to its consensus sequences. May contribute to the regulation of the intracellular level of HN (humanin) or HN-containing proteins through the proteasomal degradation pathway. Mediates MED15 ubiquitination leading to proteasomal degradation. May contribute to the innate restriction of retroviruses. Upon overexpression, reduces HIV-1 and murine leukemia virus infectivity, by suppressing viral gene expression. Antiviral activity depends on a functional E3 ubiquitin-protein ligase domain. May regulate TRIM5 turnover via the proteasome pathway, thus counteracting the TRIM5-mediated cross-species restriction of retroviral infection at early stages of the retroviral life cycle. -
Tissue specificity
Ubiquitous. -
Pathway
Protein modification; protein ubiquitination. -
Sequence similarities
Belongs to the TRIM/RBCC family.
Contains 1 B box-type zinc finger.
Contains 1 B30.2/SPRY domain.
Contains 1 RING-type zinc finger. -
Domain
The coiled-coil domain and the B30.2 domain are both necessary for interaction with HN and PAX6 (By similarity). They are also involved in MED15-binding.
The B30.2 domain may be involved cellular protein quality control by promoting the degradation of insoluble ubiquitinated proteins. -
Cellular localization
Cytoplasm. Nucleus. - Information by UniProt
Images
-
SDS-PAGE - Recombinant Human TRIM11 protein (ab164338)ab164338 on a 12.5% SDS-PAGE stained with Coomassie Blue.
Datasheets and documents
References
ab164338 has not yet been referenced specifically in any publications.
