Overview

  • Product name
    Recombinant Human TRIM13 protein
  • Protein length
    Full length protein

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      MDVMELLEEDLTCPICCSLFDDPRVLPCSHNFCKKCLEGILEGSVRNSLW RPAPFKCPTCRKETSATGINSLQVNYSLKGIVEKYNKIKISPKMPVCKGH LGQPLNIFCLTDMQLICGICATRGEHTKHVFCSIEDAYAQERDAFESLFQ SFETWRRGDALSRLDTLETSKRKSLQLLTKDSDKVKEFFEKLQHTLDQKK NEILSDFETMKLAVMQAYDPEINKLNTILQEQRMAFNIAEAFKDVSEPIV FLQQMQEFREKIKVIKETPLPPSNLPASPLMKNFDTSQWEDIKLVDVDKL SLPQDTGTFISKIPWSFYKLFLLILLLGLVIVFGPTMFLEWSLFDDLATW KGCLSNFSSYLTKTADFIEQSVFYWEQVTDGFFIFNERFKNFTLVVLNNV AEFVCKYKLL
    • Molecular weight
      74 kDa including tags
    • Amino acids
      1 to 410

Associated products

Specifications

Our Abpromise guarantee covers the use of ab131979 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

    SDS-PAGE

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 µg/µl.
    Best use within three months from the date of receipt of this protein.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • B cell chronic lymphocytic leukemia tumor suppressor Leu5
    • B-cell chronic lymphocytic leukemia tumor suppressor Leu5
    • CAR
    • DLEU5
    • E3 ubiquitin-protein ligase TRIM13
    • HGNC:9976
    • LEU5
    • Leukemia associated protein 5
    • Leukemia-associated protein 5
    • Putative tumor suppressor RFP2
    • Ret finger protein 2
    • RFP2
    • RING finger protein 77
    • RNF77
    • TRI13_HUMAN
    • Trim13
    • Tripartite motif protein 13
    • Tripartite motif-containing protein 13
    see all
  • Function
    E3 ubiquitin ligase involved in the retrotranslocation and turnover of membrane and secretory proteins from the ER through a set of processes named ER-associated degradation (ERAD). This process acts on misfolded proteins as well as in the regulated degradation of correctly folded proteins. Enhances ionizing radiation-induced p53/TP53 stability and apoptosis via ubiquitinating MDM2 and AKT1 and decreasing AKT1 kinase activity through MDM2 and AKT1 proteasomal degradation. Regulates ER stress-induced autophagy, and may act as a tumor suppressor.
  • Pathway
    Protein modification; protein ubiquitination.
  • Sequence similarities
    Belongs to the TRIM/RBCC family.
    Contains 1 B box-type zinc finger.
    Contains 1 RING-type zinc finger.
  • Domain
    The coiled-coil domain is required for the induction of autophagy during endoplasmic reticulum (ER) stress.
    The RING-type zinc finger is required for auto-polyubiquitination.
    The C-terminal domain transmembrane domain is indispensable for the localization to the ER.
  • Post-translational
    modifications
    Auto-ubiquitinated; requires the RING-type zinc finger. Auto-polyubiquitination leads to proteasomal degradation.
  • Cellular localization
    Endoplasmic reticulum membrane. Concentrates and colocalizes with p62/SQSTM1 and ZFYVE1 at the perinuclear endoplasmic reticulum.
  • Information by UniProt

Images

  • 12.5% SDS-PAGE, stained with Coomassie Blue showing ab131979.

References

ab131979 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab131979.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up