Overview

  • Product name
    Recombinant Human TRIM14 protein
  • Protein length
    Full length protein

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MAGAATGSRTPGRSELVEGCGWRCPEHGDRVAELFCRRCRRCVCALCPVL GAHRGHPVGLALEAAVHVQKLSQECLKQLAIKKQQHIDNITQIEDATEKL KANAESSKTWLKGKFTELRLLLDEEEALAKKFIDKNTQLTLQVYREQADS CREQLDIMNDLSNRVWSISQEPDPVQRLQAYTATEQEMQQQMSLGELCHP VPLSFEPVKSFFKGLVEAVESTLQTPLDIRLKESINCQLSDPSSTKPGTL LKTSPSPERSLLLKYARTPTLDPDTMHARLRLSADRLTVRCGLLGSLGPV PVLRFDALWQVLARDCFATGRHYWEVDVQEAGAGWWVGAAYASLRRRGAS AAARLGCNRQSWCLKRYDLEYWAFHDGQRSRLRPRDDLDRLGVFLDYEAG VLAFYDVTGGMSHLHTFRATFQEPLYPALRLWEGAISIPRLP
    • Amino acids
      1 to 442
    • Tags
      GST tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab160676 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • 5830400N10Rik
    • KIAA0129
    • pub
    • TRI14_HUMAN
    • TRIM14
    • tripartite motif protein 14
    • tripartite motif protein TRIM14
    • tripartite motif-containing 14
    • Tripartite motif-containing protein 14
    see all
  • Function
    Inhibits the transcriptional activity of SPI1 in a dose-dependent manner.
  • Tissue specificity
    Highest expression in liver; undetectable in skeletal muscle.
  • Sequence similarities
    Belongs to the TRIM/RBCC family.
    Contains 1 B box-type zinc finger.
    Contains 1 B30.2/SPRY domain.
  • Domain
    The B-box zinc finger is responsible for inhibition of SPI1-mediated transcriptional activation.
  • Information by UniProt

Images

  • ab160676 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab160676 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab160676.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up