Overview

Description

  • Nature

    Recombinant
  • Source

    Wheat germ
  • Amino Acid Sequence
    • Species

      Human
    • Sequence

      MAELDLMAPGPLPRATAQPPAPLSPDSGSPSPDSGSASPVEEEDVGSSEK LGRETEEQDSDSAEQGDPAGEGKEVLCDFCLDDTRRVKAVKSCLTCMVNY CEEHLQPHQVNIKLQSHLLTEPVKDHNWRYCPAHHSPLSAFCCPDQQCIC QDCCQEHSGHTIVSLDAARRDKEAELQCTQLDLERKLKLNENAISRLQAN QKSVLVSVSEVKAVAEMQFGELLAAVRKAQANVMLFLEEKEQAALSQANG IKAHLEYRSAEMEKSKQELERMAAISNTVQFLEEYCKFKNTEDITFPSVY VGLKDKLSGIRKVITESTVHLIQLLENYKKKLQEFSKEEEYDIRTQVSAV VQRKYWTSKPEPSTREQFLQYAYDITFDPDTAHKYLRLQEENRKVTNTTP WEHPYPDLPSRFLHWRQVLSQQSLYLHRYYFEVEIFGAGTYVGLTCKGID RKGEERNSCISGNNFSWSLQWNGKEFTAWYSDMETPLKAGPFRRLGVYID FPGGILSFYGVEYDTMTLVHKFACKFSEPVYAAFWLSKKENAIRIVDLGE EPEKPAPSLVGTAP
    • Amino acids

      1 to 564
    • Tags

      GST tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab161081 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form

    Liquid
  • Additional notes

    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names

    • EBBP
    • Estrogen responsive B box protein
    • Estrogen-responsive B box protein
    • TRI16_HUMAN
    • TRIM 16
    • TRIM16
    • Tripartite motif containing 16
    • Tripartite motif containing protein 16
    • Tripartite motif-containing protein 16
    see all
  • Function

    May play a role in the regulation of keratinocyte differentiation.
  • Tissue specificity

    Highest levels found in testis, ovary, small intestine, colon, placenta, heart, skeletal muscle and mammary gland. More highly expressed in the fetus than in the corresponding adult tissues. Expressed in basal keratinocytes.
  • Sequence similarities

    Belongs to the TRIM/RBCC family.
    Contains 2 B box-type zinc fingers.
    Contains 1 B30.2/SPRY domain.
  • Cellular localization

    Cytoplasm.
  • Information by UniProt

Images

  • ab161081 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab161081 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab161081.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up