Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MEAVELARKLQEEATCSICLDYFTDPVMTTCGHNFCRACIQLSWEKARGK KGRRKRKGSFPCPECREMSPQRNLLPNRLLTKVAEMAQQHPGLQKQDLCQ EHHEPLKLFCQKDQSPICVVCRESREHRLHRVLPAEEAVQGYKLKLEEDM EYLREQITRTGNLQAREEQSLAEWQGKVKERRERIVLEFEKMNLYLVEEE QRLLQALETEEEETASRLRESVACLDRQGHSLELLLLQLEERSTQGPLQM LQDMKEPLSRKNNVSVQCPEVAPPTRPRTVCRVPGQIEVLRGFLEDVVPD ATSAYPYLLLYESRQRRYLGSSPEGSGFCSKDRFVAYPCAVGQTAFSSGR HYWEVGMNITGDALWALGVCRDNVSRKDRVPKCPENGFWVVQLSKGTKYL STFSALTPVMLMEPPSHMGIFLDFEAGEVSFYSVSDGSHLHTYSQATFPG PLQPFFCLGAPKSGQMVISTVTMWVKG
    • Amino acids
      1 to 477
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab162426 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • E3 ubiquitin-protein ligase TRIM17
    • RBCC
    • RING finger protein 16
    • RING finger protein terf
    • RNF16
    • TERF
    • Testis RING finger protein
    • TRI17_HUMAN
    • TRIM 17
    • Trim17
    • Tripartite motif containing 17
    • Tripartite motif containing protein 17
    • Tripartite motif protein 17
    • Tripartite motif-containing protein 17
    see all
  • Function
    May function as an ubiquitin E3 ligase.
  • Tissue specificity
    Almost exclusively in the testis.
  • Pathway
    Protein modification; protein ubiquitination.
  • Sequence similarities
    Belongs to the TRIM/RBCC family.
    Contains 1 B box-type zinc finger.
    Contains 1 B30.2/SPRY domain.
    Contains 1 RING-type zinc finger.
  • Post-translational
    modifications
    Auto-ubiquitinated.
  • Information by UniProt

Images

  • ab162426 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab162426 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab162426.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up