Description

  • Product name

    Recombinant Human TRIM24 protein
  • Purity

    > 95 % SDS-PAGE.

  • Expression system

    Escherichia coli
  • Accession

  • Protein length

    Protein fragment
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      GLVKLTPIDKRKCERLLLFLYCHEMSLAFQDPVPLTVPDYYKIIKNPMDL STIKKRLQEDYSMYSKPEDFVADFR LIFQNCAEFNEPDSEVANAGIKLENYFEELLKNLYPEKRFPKPE
    • Predicted molecular weight

      41 kDa including tags
    • Amino acids

      896 to 1014
    • Tags

      GST tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab176928 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

  • Form

    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on Dry Ice. Store at -80°C. Avoid freeze / thaw cycle.

General Info

  • Alternative names

    • E3 ubiquitin protein ligase TRIM24
    • E3 ubiquitin-protein ligase Trim24
    • hTIF1
    • PTC6
    • RING finger protein 82
    • RNF82
    • TF1A
    • TIF1
    • TIF1 alpha
    • TIF1-alpha
    • TIF1A
    • TIF1A_HUMAN
    • TIF1ALPHA
    • Transcription intermediary factor 1-alpha
    • Transcriptional intermediary factor 1
    • Transcriptional intermediary factor 1 alpha
    • Trim24
    • Tripartite motif containing 24
    • Tripartite motif-containing protein 24
    see all
  • Function

    Transcriptional coactivator that interacts with numerous nuclear receptors and coactivators and modulates the transcription of target genes. Interacts with chromatin depending on histone H3 modifications, having the highest affinity for histone H3 that is both unmodified at 'Lys-4' (H3K4me0) and acetylated at 'Lys-23' (H3K23ac). Has E3 protein-ubiquitin ligase activity. Promotes ubiquitination and proteasomal degradation of p53/TP53. Plays a role in the regulation of cell proliferation and apoptosis, at least in part via its effects on p53/TP53 levels. Up-regulates ligand-dependent transcription activation by AR, GCR/NR3C1, thyroid hormone receptor (TR) and ESR1. Modulates transcription activation by retinoic acid (RA) receptors, including RARA. Plays a role in regulating retinoic acid-dependent proliferation of hepatocytes.
  • Pathway

    Protein modification; protein ubiquitination.
  • Involvement in disease

    Defects in TRIM24 are a cause of thyroid papillary carcinoma (TPC) [MIM:188550]. TPC is a common tumor of the thyroid that typically arises as an irregular, solid or cystic mass from otherwise normal thyroid tissue. Papillary carcinomas are malignant neoplasm characterized by the formation of numerous, irregular, finger-like projections of fibrous stroma that is covered with a surface layer of neoplastic epithelial cells. Note=A chromosomal aberration involving TRIM24/TIF1 is found in thyroid papillary carcinomas. Translocation t(7;10)(q32;q11) with RET. The translocation generates the TRIM24/RET (PTC6) oncogene.
  • Sequence similarities

    Contains 2 B box-type zinc fingers.
    Contains 1 bromo domain.
    Contains 1 PHD-type zinc finger.
    Contains 1 RING-type zinc finger.
  • Post-translational
    modifications

    Phosphorylated upon DNA damage, probably by ATM or ATR.
    Sumoylated.
  • Cellular localization

    Nucleus. Cytoplasm. Colocalizes with sites of active transcription. Detected both in nucleus and cytoplasm in some breast cancer samples. Predominantly nuclear.
  • Information by UniProt

Images

  • SDS PAGE analysis of ab176928
    Lane 1: 8 μg of ab176928
    Lane 2: 4 μg of ab176928
    Lane 3: 2 μg of ab176928

References

ab176928 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab176928.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up