Description

  • Product name

    Recombinant Human TRIM35 protein
  • Expression system

    Wheat germ
  • Accession

  • Protein length

    Full length protein
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      MERSPDVSPGPSRSFKEELLCAVCYDPFRDAVTLRCGHNFCRGCVSRCWE VQVSPTCPVCKDRASPADLRTNHTLNNLVEKLLREEAEGARWTSYRFSRV CRLHRGQLSLFCLEDKELLCCSCQADPRHQGHRVQPVKDTAHDFRAKCRN MEHALREKAKAFWAMRRSYEAIAKHNQVEAAWLEGRIRQEFDKLREFLRV EEQAILDAMAEETRQKQLLADEKMKQLTEETEVLAHEIERLQMEMKEDDV SFLMKHKSRKRRLFCTMEPEPVQPGMLIDVCKYLGSLQYRVWKKMLASVE SVPFSFDPNTAAGWLSVSDDLTSVTNHGYRVQVENPERFSSAPCLLGSRV FSQGSHAWEVALGGLQSWRVGVVRVRQDSGAEGHSHSCYHDTRSGFWYVC RTQGVEGDHCVTSDPATSPLVLAIPRRLRVELECEEGELSFYDAERHCHL YTFHARFGEVRPYFYLGGARGAGPPEPLRICPLHISVKEELDG
    • Predicted molecular weight

      83 kDa including tags
    • Amino acids

      1 to 493

Associated products

Specifications

Our Abpromise guarantee covers the use of ab131952 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

    SDS-PAGE

  • Form

    Liquid
  • Additional notes

    Protein concentration is above or equal to 0.05 µg/µl.
    Best use within three months from the date of receipt of this protein.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names

    • 0710005M05Rik
    • A430106H13Rik
    • AW046487
    • Hemopoietic lineage switch protein 5
    • HLS5
    • KIAA1098
    • Macrophage derived apoptosis inducing RBCC protein
    • MAIR
    • MGC17233
    • mKIAA1098
    • NC8
    • Protein MAIR
    • Protein Nc8
    • TRI35_HUMAN
    • TRIM35
    • Tripartite motif containing 35
    • Tripartite motif containing protein 35
    • Tripartite motif-containing protein 35
    see all
  • Function

    May play a role as a tumor suppressor. Implicated in the cell death mechanism.
  • Sequence similarities

    Belongs to the TRIM/RBCC family.
    Contains 1 B box-type zinc finger.
    Contains 1 B30.2/SPRY domain.
    Contains 1 RING-type zinc finger.
  • Domain

    The RING finger domain and the coiled-coil region are required for the apoptosis-inducing activity.
  • Cellular localization

    Cytoplasm. Nucleus. Found predominantly in cytoplasm with a granular distribution. Found in punctuate nuclear bodies.
  • Information by UniProt

Images

  • 12.5% SDS-PAGE Stained with Coomassie Blue showing ab131952.

References

ab131952 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab131952.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up