Overview

  • Product name

    Recombinant Human TRIM44 protein
  • Protein length

    Full length protein

Description

  • Nature

    Recombinant
  • Source

    Wheat germ
  • Amino Acid Sequence
    • Species

      Human
    • Sequence

      MASGVGAAFEELPHDGTCDECEPDEAPGAEEVCRECGFCYCRRHAEAHRQ KFLSHHLAEYVHGSQAWTPPADGEGAGKEEAEVKVEQEREIESEAGEESE SEEESESEEESETEEESEDESDEESEEDSEEEMEDEQESEAEEDNQEEGE SEAEGETEAESEFDPEIEMEAERVAKRKCPDHGLDLSTYCQEDRQLICVL CPVIGAHQGHQLSTLDEAFEELRSKDSGGLKAAMIELVERLKFKSSDPKV TRDQMKMFIQQEFKKVQKVIADEEQKALHLVDIQEAMATAHVTEILADIQ SHMDRLMTQMAQAKEQLDTSNESAEPKAEGDEEGPSGASEEEDT
    • Amino acids

      1 to 344
    • Tags

      GST tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab153383 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form

    Liquid
  • Additional notes

    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names

    • AN3
    • DIPB
    • HSA249128
    • MC7
    • MGC3490
    • Protein DIPB
    • TRI44_HUMAN
    • TRIM44
    • Tripartite motif containing 44
    • Tripartite motif containing protein 44
    • Tripartite motif-containing protein 44
    see all
  • Function

    May play a role in the process of differentiation and maturation of neuronal cells (By similarity). May regulate the activity of TRIM17.
  • Tissue specificity

    Highly expressed in testis.
  • Sequence similarities

    Contains 1 B box-type zinc finger.
  • Information by UniProt

Images

  • ab153383 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

This product has been referenced in:

  • Wang H  et al. TRIM44, a crucial target of miR-410, functions as a potential oncogene in osteosarcoma. Onco Targets Ther 11:3637-3647 (2018). Read more (PubMed: 29950867) »
See 1 Publication for this product

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab153383.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up