Description

  • Product name

    Recombinant Human TRIM5 alpha protein (Tagged)
  • Purity

    > 90 % SDS-PAGE.

  • Expression system

    Escherichia coli
  • Accession

  • Protein length

    Full length protein
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      MASGILVNVKEEVTCPICLELLTQPLSLDCGHSFCQACLTANHKKSMLDK GESSCPVCRISYQPENIRPNRHVANIVEKLREVKLSPEGQKVDHCARHGE KLLLFCQEDGKVICWLCERSQEHRGHHTFLTEEVAREYQVKLQAALEMLR QKQQEAEELEADIREEKASWKTQIQYDKTNVLADFEQLRDILDWEESNEL QNLEKEEEDILKSLTNSETEMVQQTQSLRELISDLEHRLQGSVMELLQGV DGVIKRTENVTLKKPETFPKNQRRVFRAPDLKGMLEVFRELTDVRRYWVD VTVAPNNISCAVISEDKRQVSSPKPQIIYGARGTRYQTFVNFNYCTGILG SQSITSGKHYWEVDVSKKTAWILGVCAGFQPDAMCNIEKNENYQPKYGYW VIGLEEGVKCSAFQDSSFHTPSVPFIVPLSVIICPDRVGVFLDYEACTVS FFNITNHGFLIYKFSHCSFSQPVFPYLNPRKCGVPMTLCSPSS
    • Predicted molecular weight

      70 kDa including tags
    • Amino acids

      1 to 493
    • Additional sequence information

      N-terminal 6XHis-B2M-tagged.

Specifications

Our Abpromise guarantee covers the use of ab239570 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

  • Form

    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    Constituents: Tris buffer, 50% Glycerol

General Info

  • Alternative names

    • RING finger protein 88
    • RNF88
    • TRIM5
    • TRIM5_HUMAN
    • TRIM5alpha
    • Tripartite motif containing 5
    • tripartite motif protein TRIM5
    • Tripartite motif-containing protein 5
    see all
  • Function

    Isoform Alpha is a retrovirus restriction factor, which mediates species-specific, early block to retrovirus infection. Targets retroviral capsid soon after entry into the cell, and prevents reverse transcription of the virus RNA genome. Isoform Alpha trimers may make multiple contacts with the hexameric lattice of CA proteins which constitute the surface of retrovirion core, and somehow inactivate the virus. Restricts efficiently infection by N-MLV, but not HIV-1. May have E3 ubiquitin-protein ligase activity.
  • Pathway

    Protein modification; protein ubiquitination.
  • Sequence similarities

    Belongs to the TRIM/RBCC family.
    Contains 1 B box-type zinc finger.
    Contains 1 B30.2/SPRY domain.
    Contains 1 RING-type zinc finger.
  • Domain

    The RING-type zinc finger domain mediates binding to an E2 ubiquitin-conjugating enzyme.
  • Post-translational
    modifications

    Ubiquitinates itself in a RING finger- and UBE2D2-dependent manner (in vitro).
  • Cellular localization

    Cytoplasm > P-body. Cytoplasmic bodies.
  • Information by UniProt

Images

  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel analysis of ab239570.

References

ab239570 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab239570.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up