Description

  • Product name

    Recombinant Human TRIO protein
    See all TRIO proteins and peptides
  • Expression system

    Wheat germ
  • Protein length

    Protein fragment
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      ERKSSSLKRRHYVLQELVETERDYVRDLGYVVEGYMALMKEDGVPDDMKG KDKIVFGNIHQIYDWHRDFFLGELEKCLEDPEKLGSLFVKHERRLHMYIA YCQNKPKSEH
    • Amino acids

      1961 to 2070
    • Tags

      GST tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab159748 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form

    Liquid
  • Additional notes

    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names

    • ARHGEF23
    • MEBAS
    • MRD44
    • PTPRF-interacting protein
    • tgat
    • trio
    • Trio Rho guanine nucleotide exchange factor
    • TRIO_HUMAN
    • Triple functional domain (PTPRF interacting)
    • Triple functional domain protein
    see all
  • Function

    Promotes the exchange of GDP by GTP. Together with leukocyte antigen-related (LAR) protein, it could play a role in coordinating cell-matrix and cytoskeletal rearrangements necessary for cell migration and cell growth.
  • Tissue specificity

    Highly expressed in heart, skeletal muscle, brain, pancreas, placenta, liver, kidney and lung.
  • Sequence similarities

    Belongs to the protein kinase superfamily. CAMK Ser/Thr protein kinase family.
    Contains 1 CRAL-TRIO domain.
    Contains 2 DH (DBL-homology) domains.
    Contains 1 Ig-like C2-type (immunoglobulin-like) domain.
    Contains 2 PH domains.
    Contains 1 protein kinase domain.
    Contains 2 SH3 domains.
    Contains 4 spectrin repeats.
  • Domain

    The N-terminal DBL/GEF domain specifically catalyzes nucleotide exchange for RAC1, leading to the activation of Jun kinase and the production of membrane ruffles. The second DBL/GEF domain is an exchange factor for rhoa and induces the formation of stress fibers.
  • Post-translational
    modifications

    Phosphorylated on serine residue(s).
  • Cellular localization

    Cytoplasm.
  • Information by UniProt

Images

  • ab159748 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab159748 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab159748.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up