Recombinant human Triosephosphate isomerase protein (Active) (ab224782)

Overview

Description

  • Nature

    Recombinant
  • Source

    Escherichia coli
  • Amino Acid Sequence
    • Accession
    • Species

      Human
    • Sequence

      MGSSHHHHHHSSGLVPRGSHMAPSRKFFVGGNWKMNGRKQSLGELIGTLN AAKVPADTEVVCAPPTAYIDFARQKLDPKIAVAAQNCYKVTNGAFTGEIS PGMIKDCGATWVVLGHSERRHVFGESDELIGQKVAHALAEGLGVIACIGE KLDEREAGITEKVVFEQTKVIADNVKDWSKVVLAYEPVWAIGTGKTATPQ QAQEVHEKLRGWLKSNVSDAVAQSTRIIYGGSVTGATCKELASQPDVDGF LVGGASLKPEFVDIINAKQ
    • Molecular weight

      29 kDa including tags
    • Amino acids

      1 to 249
    • Tags

      His tag N-Terminus
    • Additional sequence information

      NP_000356.

Specifications

Our Abpromise guarantee covers the use of ab224782 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Biological activity

    Specific activity is > 3000 units/mg, in which one unit will convert 1.0 µmole of D-glyceraldehyde-3-phosphate to dihydroxyacetone phosphate per minute at pH 7.5 at 25°C.

  • Applications

    Functional Studies

    SDS-PAGE

    Mass Spectrometry

  • Mass spectrometry

    MALDI-TOF
  • Purity

    > 95 % SDS-PAGE.
    ab224782 was purified using conventional chromatography techniques.
  • Form

    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    pH: 8.00
    Constituents: 0.02% DTT, 10% Glycerol, 0.32% Tris HCl

    This product is an active protein and may elicit a biological response in vivo, handle with caution.

General Info

  • Alternative names

    • epididymis secretory protein Li 49
    • HEL-S-49
    • MGC88108
    • TIM
    • TPI
    • TPI 1
    • TPI1
    • TPID
    • Triose phosphate isomerase
    • Triose phosphate isomerase 1
    • Triosephosphate isomerase
    • Triosephosphate isomerase 1
    see all
  • Relevance

    Triosephosphate isomerase (TIM) catalyses the reversible interconversion of G3P and DHAP. Only G3P can be used in glycolysis, therefore TIM is essential for energy production, allowing two molecules of G3P to be produced for every glucose molecule, thereby doubling the energy yield. Defects in TPI1 are the cause of triosephosphate isomerase deficiency (TPI deficiency) [MIM:190450]. TPI deficiency is an autosomal recessive disorder. It is the most severe clinical disorder of glycolysis. It is associated with neonatal jaundice, chronic hemolytic anemia, progressive neuromuscular dysfunction, cardiomyopathy and increased susceptibility to infection.
  • Cellular localization

    Cytoplasmic and Nuclear; extracellular vesicle exosome; extracellular space.

Images

  • 15% SDS-PAGE analysis of 3 µg ab224782.

     

References

ab224782 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab224782.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up