Overview

  • Product name

    Recombinant Human TRIP12/ULF protein
  • Protein length

    Protein fragment

Description

  • Nature

    Recombinant
  • Source

    Wheat germ
  • Amino Acid Sequence
    • Species

      Human
    • Sequence

      MSNRPNNNPGGSLRRSQRNTAGAQPQDDSIGGRSCSSSSAVIVPQPEDPD RANTSERQKTGQVPKKDNSRGVKRSASPDYNRTNSPSSAKKPKALQHTES PSETNKPHSK
    • Amino acids

      1 to 110
    • Tags

      GST tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab160426 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form

    Liquid
  • Additional notes

    Protein concentration is above or equal to 0.05 mg/ml.

     This product was previously labelled as TRIP12

     

  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names

    • KIAA0045
    • MGC138849
    • MGC138850
    • Thyroid hormone receptor interactor 12
    • Thyroid receptor interacting protein 12
    • TRIP 12
    see all
  • Relevance

    TRIP12 (thyroid hormone receptor interactor 12) is an ATP-dependent multisubunit protein that activates the proteolytic activities of the multifunctional proteinase (20S proteasome) of the 26S complex. TRP12 specifically interacts with the ligand binding domain of the thyroid hormone receptor (in a thyroid hormone T3-independent manner) and with retinoid X receptor (RXR). TRP12 was originally identified as a factor that interacts with the thyroid hormone receptor. It was later found to also interact with AAP-BP1, a component of the NEDD8 –activating enzyme, and function as an E3 ubiquitin ligase for AAP-BP1.

Images

  • ab160426 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab160426 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab160426.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up