Overview

Description

  • Nature

    Recombinant
  • Source

    HEK 293 cells
  • Amino Acid Sequence
    • Accession
    • Species

      Human
    • Sequence

      CPTSCKCSASRIWCSDPSPGIVAFPRLEPNSVDPENITEIFIANQKRLEI INEDDVEAYVGLRNLTIVDSGLKFVAHKAFLKNSNLQHINFTRNKLTSLS RKHFRHLDLSELILVGNPFTCSCDIMWIKTLQEAKSSPDTQDLYCLNESS KNIPLANLQIPNCGLPSANLAAPNLTVEEGKSITLSCSVAGDPVPNMYWD VGNLVSKHMNETSHTQGSLRITNISSDDSGKQISCVAENLVGEDQDSVNL TVHFAPTITFLESPTSDHHWCIPFTVKGNPKPALQWFYNGAILNESKYIC TKIHVTNHTEYHGCLQLDNPTHMNNGDYTLIAKNEYGKDEKQISAHFMGW PGIDDGANPNYPDVIYEDYGTAANDIGDTTNRSNEIPSTDVTDKTGREH
    • Molecular weight

      70 kDa including tags
    • Amino acids

      32 to 430
    • Additional sequence information

      Fused with a Human IgG1 Fc tag at the C-terminus (AAH31835).

Specifications

Our Abpromise guarantee covers the use of ab221396 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Endotoxin level

    < 1.000 Eu/µg
  • Purity

    > 98 % SDS-PAGE.

  • Form

    Lyophilised
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    pH: 7.5
    Constituents: 0.61% Tris, 0.75% Glycine, 5% Trehalose

  • Reconstitution
    Reconstitute the lyophilized product in sterile deionized water to a final concentration of 1 mg/ml. Solubilize for 30 to 60 minutes at room temperature with occasional gentle mixing. Carrier protein (0.1% HSA or BSA) is strongly recommended for further dilution and long term storage.

General Info

  • Alternative names

    • AI848316
    • BDNF tropomyosine receptor kinase B
    • BDNF/NT 3 growth factors receptor
    • BDNF/NT-3 growth factors receptor
    • Brain derived neurotrophic factor receptor
    • C030027L06Rik
    • EC 2.7.10.1
    • GP145 TrkB
    • GP145-TrkB
    • GP145-TrkB/GP95-TrkB
    • GP95 TrkB
    • Neurotrophic receptor tyrosine kinase 2
    • Neurotrophic tyrosine kinase receptor type 2
    • Neurotrophin receptor tyrosine kinase type 2
    • NTRK 2
    • Ntrk2
    • NTRK2_HUMAN
    • Obesity, hyperphagia, and developmental delay, included
    • RATTRKB1
    • Tkrb
    • Trk B
    • Trk-B
    • TRKB
    • TrkB tyrosine kinase
    • TRKB1
    • Tropomyosin related kinase B
    • tyrosine kinase receptor B
    • Tyrosine receptor kinase B
    see all
  • Function

    Receptor for brain-derived neurotrophic factor (BDNF), neurotrophin-3 and neurotrophin-4/5 but not nerve growth factor (NGF). Involved in the development and/or maintenance of the nervous system. This is a tyrosine-protein kinase receptor. Known substrates for the TRK receptors are SHC1, PI-3 kinase, and PLC-gamma-1.
  • Tissue specificity

    Isoform TrkB is widely expressed, mainly in the nervous tissue. In the CNS, expression is observed in the cerebral cortex, hippocampus, thalamus, choroid plexus, granular layer of the cerebellum, brain stem, and spinal cord. In the peripheral nervous system, it is expressed in many cranial ganglia, the ophtalmic nerve, the vestibular system, multiple facial structures, the submaxillary glands, and dorsal root ganglia. Isoform TrkB-T1 is expressed in multiple tissues, mainly in brain, pancreas, kidney and heart. Isoform TrkB-T-Shc is predominantly expressed in brain.
  • Sequence similarities

    Belongs to the protein kinase superfamily. Tyr protein kinase family. Insulin receptor subfamily.
    Contains 2 Ig-like C2-type (immunoglobulin-like) domains.
    Contains 2 LRR (leucine-rich) repeats.
    Contains 1 LRRCT domain.
    Contains 1 LRRNT domain.
    Contains 1 protein kinase domain.
  • Post-translational
    modifications

    Ligand-mediated auto-phosphorylation.
  • Cellular localization

    Membrane.
  • Information by UniProt

Images

  • SDS-PAGE (DTT reduced) analysis of ab221396 followed by staining overnight with Coomassie Blue.  DTT-reduced Protein migrates as 95-120 kDa in SDS-PAGE due to glycosylation.

     

References

ab221396 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab221396.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up