Overview

  • Product name
    Recombinant Human TRM6 protein
  • Protein length
    Full length protein

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MEGSGEQPGPQPQHPGDHRIRDGDFVVLKREDVFKAVQVQRRKKVTFEKQ WFYLDNVIGHSYGTAFEVTSGGSLQPKKKREEPTAETKEAGTDNRNIVDD GKSQKLTQDDIKALKDKGIKGEEIVQQLIENSTTFRDKTEFAQDKYIKKK KKKYEAIITVVKPSTRILSIMYYAREPGKINHMRYDTLAQMLTLGNIRAG NKMIVMETCAGLVLGAMMERMGGFGSIIQLYPGGGPVRAATACFGFPKSF LSGLYEFPLNKVDSLLHGTFSAKMLSSEPKDSALVEESNGTLEEKQASEQ ENEDSMAEAPESNHPEDQETMETISQDPEHKGPKERGSKKDYIQEKQRRQ EEQRKRHLEAAALLSERNADGLIVASRFHPTPLLLSLLDFVAPSRPFVVY CQYKEPLLECYTKLRERGGVINLRLSETWLRNYQVLPDRSHPKLLMSGGG GYLLSGFTVAMDNLKADTSLKSNASTLESHETEEPAAKKRKCPESDS
    • Amino acids
      1 to 497
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab162610 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.

    Previously labelled as TRMT6. 

  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • KIAA1153
    • Adenine N
    • CGI 09
    • CGI09
    • GCD10
    • Gcd10p
    • MGC5029
    • TRM6
    • TRM6_HUMAN
    • trmt6
    • tRNA (adenine-N(1)-)-methyltransferase non-catalytic subunit TRM6
    • tRNA methyltransferase 6
    • tRNA methyltransferase 6 homolog (S. cerevisiae)
    • tRNA(m1A58)-methyltransferase subunit TRM6
    • tRNA(m1A58)MTase subunit TRM6
    see all
  • Function
    Substrate-binding subunit of tRNA (adenine-N(1)-)-methyltransferase, which catalyzes the formation of N(1)-methyladenine at position 58 (m1A58) in initiator methionyl-tRNA.
  • Tissue specificity
    Expressed in brain, liver, testis and ovary.
  • Sequence similarities
    Belongs to the TRM6/GCD10 family.
  • Post-translational
    modifications
    Phosphorylated upon DNA damage, probably by ATM or ATR.
  • Cellular localization
    Nucleus.
  • Information by UniProt

Images

  • ab162610 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab162610 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab162610.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up