Recombinant Human TRMT2B protein (ab164170)

Overview

  • Product name
    Recombinant Human TRMT2B protein
  • Protein length
    Full length protein

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MAGLKRRVPLHSLRYFISMVGLFSKPGLLPWYARNPPGWSQLFLGTVCKG DFTRVIATKCQKGQKSQKKPSHLGPLDGSWQERLADVVTPLWRLSYEEQL KVKFAAQKKILQRLESYIQMLNGVSVTTAVPKSERLSCLLHPIIPSPVIN GYRNKSTFSVNRGPDGNPKTVGFYLGTWRDGNVVCVQSNHLKNIPEKHSQ VAQYYEVFLRQSPLEPCLVFHEGGYWRELTVRTNSQGHTMAIITFHPQKL SQEELHVQKEIVKEFFIRGPGAACGLTSLYFQESTMTRCSHQQSPYQLLF GEPYIFEELLSLKIRISPDAFFQINTAGAEMLYRTVGELTGVNSDTILLD ICCGTGVIGLSLAQHTSRVLGIELLEQAVEDARWTAAFNGITNSEFHTGQ AEKILPGLLKSKEDGQSIVAVVNPARAGLHYKVIQAIRNFRAIHTLVFVS CKLHGESTRNVIELCCPPDPAKKLLGEPFVLQQAVPVDLFPHTPHCELVL LFTR
    • Amino acids
      1 to 504
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab164170 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • Chromosome X open reading frame 34
    • CXorf34
    • dJ341D10.3
    • FLJ12687
    • Putative methyltransferase CXorf34
    • TRM2 homolog
    • TRM2 tRNA methyltransferase 2 homolog B
    • TRM2 tRNA methyltransferase 2 homolog B (S. cerevisiae)
    • TRM2_HUMAN
    • TRMT2B
    • tRNA (uracil 5 )methyltransferase homolog
    • tRNA (uracil(54)-C(5))-methyltransferase homolog
    • tRNA (uracil-5-)-methyltransferase homolog
    • tRNA methyltransferase 2 homolog B
    see all
  • Function
    Probable S-adenosyl-L-methionine-dependent methyltransferase that catalyzes the formation of 5-methyl-uridine at position 54 (m5U54) in all tRNA. May also have a role in tRNA stabilization or maturation.
  • Sequence similarities
    Belongs to the methyltransferase superfamily. RNA M5U methyltransferase family.
  • Information by UniProt

Images

  • ab164170 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab164170 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab164170.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up