Overview

Description

  • Nature

    Recombinant
  • Source

    Wheat germ
  • Amino Acid Sequence
    • Species

      Human
    • Sequence

      RLDPARASCFSRLEGPGPRGRTLCPQRLQALISPSGPSFHPSTHPSFQEL RRETAGSSRTSVSQASGLLLETPVQPAFSLPKGEREVVTHSDEGGVASLG
    • Amino acids

      181 to 280
    • Tags

      GST tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab160769 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form

    Liquid
  • Additional notes

    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names

    • Tastin
    • TROAP
    • TROAP_HUMAN
    • Trophinin assisting protein
    • Trophinin associated protein
    • trophinin associated protein (tastin)
    • Trophinin-assisting protein
    • Trophinin-associated protein
    see all
  • Function

    Could be involved with bystin and trophinin in a cell adhesion molecule complex that mediates an initial attachment of the blastocyst to uterine epithelial cells at the time of the embryo implantation.
  • Tissue specificity

    Strong expression at implantation sites. Was exclusively localized to the apical side of the syncytiotrophoblast. Also found in macrophages.
  • Cellular localization

    Cytoplasm.
  • Information by UniProt

Images

  • ab160769 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab160769 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab160769.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up