Overview

  • Product name

    Recombinant Human Tropomodulin 4 protein
  • Protein length

    Full length protein

Description

  • Nature

    Recombinant
  • Source

    Wheat germ
  • Amino Acid Sequence
    • Species

      Human
    • Sequence

      MSSYQKELEKYRDIDEDEILRTLSPEELEQLDCELQEMDPENMLLPAGLR QRDQTKKSPTGPLDREALLQYLEQQALEVKERDDLVPFTGEKKGKPYIQP KREIPAEEQITLEPELEEALAHATDAEMCDIAAILDMYTLMSNKQYYDAL CSGEICNTEGISSVVQPDKYKPVPDEPPNPTNIEEILKRVRSNDKELEEV NLNNIQDIPIPMLSELCEAMKANTYVRSFSLVATRSGDPIANAVADMLRE NRSLQSLNIESNFISSTGLMAVLKAVRENATLTELRVDNQRQWPGDAVEM EMATVLEQRPSIVRFGYHFTQQGPRARAAQAMTRNNELRRQQKKR
    • Amino acids

      1 to 345
    • Tags

      GST tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab162232 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form

    Liquid
  • Additional notes

    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names

    • Actin capping protein
    • SK TMOD
    • Sk-Tmod
    • Skeletal muscle tropomodulin
    • SKTMOD
    • TMOD 4
    • TMOD4
    • Tropomodulin 4 (muscle)
    • Tropomodulin-4
    see all
  • Relevance

    Tropomodulin 4 prevents the elongation and depolymerization of the actin filaments at the pointed end, and intervenes in the formation of the short actin protofilament, which determines the structure of the membrane skeleton.
  • Cellular localization

    Cytoplasm, cytoskeleton.

Images

  • ab162232 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab162232 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab162232.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up