Recombinant Human Tropomyosin 1 (alpha) protein (ab166876)
Key features and details
- Expression system: Escherichia coli
- Purity: > 95% SDS-PAGE
- Tags: His tag N-Terminus
- Suitable for: ELISA, SDS-PAGE
Description
-
Product name
Recombinant Human Tropomyosin 1 (alpha) protein
See all Tropomyosin 1 (alpha) proteins and peptides -
Purity
> 95 % SDS-PAGE. -
Expression system
Escherichia coli -
Protein length
Full length protein -
Animal free
No -
Nature
Recombinant -
-
Species
Human -
Sequence
MDAIKKKMQMLKLDKENALDRAEQAEADKKAAEDRSKQLEDELVSLQKKL KGTEDELDKYSEALKDAQEKLELAEKKATDAEADVASLNRRIQLVEEELD RAQERLATALQKLEEAEKAADESERGMKVIESRAQKDEEKMEIQEIQLKE AKHIAEDADRKYEEVARKLVIIESDLERAEERAELSEGKCAELEEELKTV TNNLKSLEAQAEKYSQKEDRYEEEIKVLSDKLKEAETRAEFAERSVTKLE KSIDDLEEKVAHAKEENLSMHQMLDQTLLELNNM -
Predicted molecular weight
35 kDa including tags -
Amino acids
1 to 284 -
Tags
His tag N-Terminus
-
Associated products
-
Related Products
Specifications
Our Abpromise guarantee covers the use of ab166876 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
-
Applications
ELISA
SDS-PAGE
-
Form
Liquid -
Concentration information loading...
Preparation and Storage
-
Stability and Storage
Shipped at 4°C. Store at -20°C.
Constituent: 50% Glycerol
Carrier free. Buffered with saline or Tris.
General Info
-
Alternative names
- AA986836
- AI854628
- Alpha tropomyosin
see all -
Function
Binds to actin filaments in muscle and non-muscle cells. Plays a central role, in association with the troponin complex, in the calcium dependent regulation of vertebrate striated muscle contraction. Smooth muscle contraction is regulated by interaction with caldesmon. In non-muscle cells is implicated in stabilizing cytoskeleton actin filaments. -
Tissue specificity
Detected in primary breast cancer tissues but undetectable in normal breast tissues in Sudanese patients. Isoform 1 is expressed in adult and fetal skeletal muscle and cardiac tissues, with higher expression levels in the cardiac tissues. Isoform 10 is expressed in adult and fetal cardiac tissues, but not in skeletal muscle. -
Involvement in disease
Defects in TPM1 are the cause of cardiomyopathy familial hypertrophic type 3 (CMH3) [MIM:115196]. Familial hypertrophic cardiomyopathy is a hereditary heart disorder characterized by ventricular hypertrophy, which is usually asymmetric and often involves the interventricular septum. The symptoms include dyspnea, syncope, collapse, palpitations, and chest pain. They can be readily provoked by exercise. The disorder has inter- and intrafamilial variability ranging from benign to malignant forms with high risk of cardiac failure and sudden cardiac death.
Defects in TPM1 are the cause of cardiomyopathy dilated type 1Y (CMD1Y) [MIM:611878]. Dilated cardiomyopathy is a disorder characterized by ventricular dilation and impaired systolic function, resulting in congestive heart failure and arrhythmia. Patients are at risk of premature death. -
Sequence similarities
Belongs to the tropomyosin family. -
Domain
The molecule is in a coiled coil structure that is formed by 2 polypeptide chains. The sequence exhibits a prominent seven-residues periodicity. -
Cellular localization
Cytoplasm > cytoskeleton. - Information by UniProt
Protocols
To our knowledge, customised protocols are not required for this product. Please try the standard protocols listed below and let us know how you get on.
Datasheets and documents
References (0)
ab166876 has not yet been referenced specifically in any publications.