Description

  • Product name

    Recombinant Human Tropomyosin 1 (alpha) protein
    See all Tropomyosin 1 (alpha) proteins and peptides
  • Purity

    > 90 % SDS-PAGE.
    ab99214 is purified using conventional chromatography techniques.
  • Expression system

    Escherichia coli
  • Accession

  • Protein length

    Full length protein
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      MGSSHHHHHHSSGLVPRGSHMDAIKKKMQMLKLDKENALDRAEQAEADKK AAEDRSKQLEDELVSLQKKLKGTEDELDKYSEALKDAQEKLELAEKKATD AEADVASLNRRIQLVEEELDRAQERLATALQKLEEAEKAADESERGMKVI ESRAQKDEEKMEIQEIQLKEAKHIAEDADRKYEEVARKLVIIESDLERAE ERAELSEGQVRQLEEQLRIMDQTLKALMAAEDKYSQKEDRYEEEIKVLSD KLKEAETRAEFAERSVTKLEKSIDDLEDELYAQKLKYKAISEELDHALND MTSM
    • Predicted molecular weight

      35 kDa including tags
    • Amino acids

      1 to 284
    • Tags

      His tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab99214 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Mass Spectrometry

    SDS-PAGE

  • Mass spectrometry

    MALDI-TOF
  • Form

    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Upon delivery aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.0154% DTT, 0.316% Tris HCl, 20% Glycerol, 0.58% Sodium chloride

General Info

  • Alternative names

    • AA986836
    • AI854628
    • Alpha tropomyosin
    • alpha-TM
    • Alpha-tropomyosin
    • C15orf13
    • cardiomyopathy, hypertrophic 3
    • CMD1Y
    • CMH3
    • HTM alpha
    • HTM-alpha
    • OTTHUMP00000163688
    • sarcomeric tropomyosin kappa
    • TM2
    • Tmpa
    • TMSA
    • Tpm-1
    • TPM1
    • TPM1_HUMAN
    • Tropomyosin 1
    • tropomyosin 1 (alpha)
    • tropomyosin 1 (alpha) isoform 1
    • tropomyosin 1 (alpha) isoform 2
    • tropomyosin 1 (alpha) isoform 3
    • tropomyosin 1 (alpha) isoform 4
    • tropomyosin 1 (alpha) isoform 5
    • tropomyosin 1 (alpha) isoform 6
    • tropomyosin 1 (alpha) isoform 7
    • Tropomyosin alpha 1 chain
    • Tropomyosin alpha-1 chain
    • Tropomyosin, skeletal muscle alpha
    • Tropomyosin-1
    see all
  • Function

    Binds to actin filaments in muscle and non-muscle cells. Plays a central role, in association with the troponin complex, in the calcium dependent regulation of vertebrate striated muscle contraction. Smooth muscle contraction is regulated by interaction with caldesmon. In non-muscle cells is implicated in stabilizing cytoskeleton actin filaments.
  • Tissue specificity

    Detected in primary breast cancer tissues but undetectable in normal breast tissues in Sudanese patients. Isoform 1 is expressed in adult and fetal skeletal muscle and cardiac tissues, with higher expression levels in the cardiac tissues. Isoform 10 is expressed in adult and fetal cardiac tissues, but not in skeletal muscle.
  • Involvement in disease

    Defects in TPM1 are the cause of cardiomyopathy familial hypertrophic type 3 (CMH3) [MIM:115196]. Familial hypertrophic cardiomyopathy is a hereditary heart disorder characterized by ventricular hypertrophy, which is usually asymmetric and often involves the interventricular septum. The symptoms include dyspnea, syncope, collapse, palpitations, and chest pain. They can be readily provoked by exercise. The disorder has inter- and intrafamilial variability ranging from benign to malignant forms with high risk of cardiac failure and sudden cardiac death.
    Defects in TPM1 are the cause of cardiomyopathy dilated type 1Y (CMD1Y) [MIM:611878]. Dilated cardiomyopathy is a disorder characterized by ventricular dilation and impaired systolic function, resulting in congestive heart failure and arrhythmia. Patients are at risk of premature death.
  • Sequence similarities

    Belongs to the tropomyosin family.
  • Domain

    The molecule is in a coiled coil structure that is formed by 2 polypeptide chains. The sequence exhibits a prominent seven-residues periodicity.
  • Cellular localization

    Cytoplasm > cytoskeleton.
  • Information by UniProt

Images

  • 15% SDS-PAGE analysis of 3µg ab99214.

References

ab99214 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab99214.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up