Overview

Description

  • Nature

    Recombinant
  • Source

    Escherichia coli
  • Amino Acid Sequence
    • Accession
    • Species

      Human
    • Sequence

      MGSSHHHHHHSSGLVPRGSHMGDEEKRNRAITARRQHLKSVMLQIAATEL EKEESRREAEKQNYLAEHCPPLHIPGSMSEVQELCKQLHAKIDAAEEEKY DMEVRVQKTSKELEDMNQKLFDLRGKFKRPPLRRVRMSADAMLKALLGSK HKVCMDLRANLKQVKKEDTEKERDLRDVGDWRKNIEEKSGMEGRKKMFES ES
    • Molecular weight

      24 kDa including tags
    • Amino acids

      1 to 182
    • Tags

      His tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab137152 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

  • Purity

    > 90 % SDS-PAGE.

  • Form

    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    pH: 8.00
    Constituents: 12.01% Urea, 0.32% Tris HCl, 20% Glycerol, 1.17% Sodium chloride

General Info

  • Alternative names

    • AMCD 2B
    • AMCD2B
    • DA 2B
    • DA2B
    • fast skeletal muscle
    • Fast twitch skeletal muscle troponin I
    • fast-twitch isoform
    • FSSV
    • fsTnI
    • TNNI 2
    • Tnni2
    • TNNI2_HUMAN
    • tro
    • Troponin I
    • Troponin I fast skeletal muscle
    • Troponin I fast twitch 2
    • Troponin I fast twitch isoform
    • Troponin I fast twitch skeletal muscle isoform
    • Troponin I skeletal fast
    • Troponin I type 2
    • Troponin I type 2 (skeletal fast)
    see all
  • Function

    Troponin I is the inhibitory subunit of troponin, the thin filament regulatory complex which confers calcium-sensitivity to striated muscle actomyosin ATPase activity.
  • Involvement in disease

    Defects in TNNI2 are a cause of distal arthrogryposis type 2B (DA2B) [MIM:601680]; also known as arthrogryposis multiplex congenita, distal, type 2B (AMCD2B). DA2B is a form of inherited multiple congenital contractures. Affected individuals have vertical talus, ulnar deviation in the hands, severe camptodactyly, and a distinctive face characterized by a triangular shape, prominent nasolabial folds, small mouth and a prominent chin.
  • Sequence similarities

    Belongs to the troponin I family.
  • Information by UniProt

Images

  • 15% SDS-PAGE analysis of 3 µg ab137152.

References

ab137152 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab137152.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up