Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MSPLWWGFLLSCLGCKILPGAQGQFPRVCMTVDSLVNKECCPRLGAESAN VCGSQQGRGQCTEVRADTRPWSGPYILRNQDDRELWPRKFFHRTCKCTGN FAGYNCGDCKFGWTGPNCERKKPPVIRQNIHSLSPQEREQFLGALDLAKK RVHPDYVITTQHWLGLLGPNGTQPQFANCSVYDFFVWLHYYSVRDTLLGP GRPYRAIDFSHQGPAFVTWHRYHLLCLERDLQRLIGNESFALPYWNFATG RNECDVCTDQLFGAARPDDPTLISRNSRFSSWETVCDSLDDYNHLVTLCN GTYEGLLRRNQMGRNSMKLPTLKDIRDCLSLQKFDNPPFFQNSTFSFRNA LEGFDKADGTLDSQVMSLHNLVHSFLNGTNALPHSAANDPIFVVLHSFTD AIFDEWMKRFNPPADAWPQELAPIGHNRMYNMVPFFPPVTNEELFLTSDQ LGYSYAIDLPVSVEETPGWPTTLLVVMGTLVALVGLFVLLAFLQYRRLRK GYTPLMETHLSSKRYTEEA
    • Amino acids
      1 to 519
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab158267 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • L dopachrome tautomerase
    • DCT
    • Dopachrome delta isomerase
    • Dopachrome tautomerase
    • Dopachrome tautomerase dopachrome delta isomerase, tyrosine related protein 2
    • DT
    • EC 5.3.3.12
    • L dopachrome Delta isomerase
    • L-dopachrome Delta-isomerase
    • L-dopachrome tautomerase
    • TRP 2
    • TRP-2
    • TRP2
    • Tyrosinase related protein 2
    • Tyrosinase-related protein 2
    • TYRP2
    • TYRP2_HUMAN
    see all
  • Function
    Involved in regulating eumelanin and phaeomelanin levels.
  • Pathway
    Pigment biosynthesis; melanin biosynthesis.
  • Sequence similarities
    Belongs to the tyrosinase family.
  • Cellular localization
    Melanosome membrane.
  • Information by UniProt

Images

  • ab158267 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

This product has been referenced in:
  • Hu S  et al. The effects of IGF1 on the melanogenesis in alpaca melanocytes in vitro. In Vitro Cell Dev Biol Anim 52:806-11 (2016). Read more (PubMed: 27173613) »

See 1 Publication for this product

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab158267.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up