Description

  • Product name

    Recombinant Human TRP2/DCT protein
    See all TRP2/DCT proteins and peptides
  • Expression system

    Wheat germ
  • Accession

  • Protein length

    Protein fragment
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      CTEVRADTRPWSGPYILRNQDDRELWPRKFFHRTCKCTGNFAGYNCGDCK FGWTGPNCERKKPPVIRQNIHSLSPQEREQFLGALDLAKKRVHPDYVITT
    • Amino acids

      61 to 160
    • Tags

      GST tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab158268 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form

    Liquid
  • Additional notes

    Protein concentration is above or equal to 0.05 mg/ml.

    Previously labelled as TRP2

  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names

    • L dopachrome tautomerase
    • DCT
    • Dopachrome delta isomerase
    • Dopachrome tautomerase
    • Dopachrome tautomerase dopachrome delta isomerase, tyrosine related protein 2
    • DT
    • EC 5.3.3.12
    • L dopachrome Delta isomerase
    • L-dopachrome Delta-isomerase
    • L-dopachrome tautomerase
    • TRP 2
    • TRP-2
    • TRP2
    • Tyrosinase related protein 2
    • Tyrosinase-related protein 2
    • TYRP2
    • TYRP2_HUMAN
    see all
  • Function

    Involved in regulating eumelanin and phaeomelanin levels.
  • Pathway

    Pigment biosynthesis; melanin biosynthesis.
  • Sequence similarities

    Belongs to the tyrosinase family.
  • Cellular localization

    Melanosome membrane.
  • Information by UniProt

Images

  • ab158268 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

This product has been referenced in:

  • Fässler M  et al. Antibodies as biomarker candidates for response and survival to checkpoint inhibitors in melanoma patients. J Immunother Cancer 7:50 (2019). Read more (PubMed: 30786924) »
See 1 Publication for this product

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab158268.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up