Description

  • Product name

    Recombinant Human TRP2/DCT protein (His tag)
    See all TRP2/DCT proteins and peptides
  • Purity

    > 90 % SDS-PAGE.
    ab222949 was purified using conventional chromatography techniques.
  • Endotoxin level

    < 1.000 Eu/µg
  • Expression system

    Baculovirus infected insect cells
  • Accession

  • Protein length

    Protein fragment
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      QFPRVCMTVDSLVNKECCPRLGAESANVCGSQQGRGQCTEVRADTRPWSG PYILRNQDDRELWPRKFFHRTCKCTGNFAGYNCGDCKFGWTGPNCERKKP PVIRQNIHSLSPQEREQFLGALDLAKKRVHPDYVITTQHWLGLLGPNGTQ PQFANCSVYDFFVWLHYYSVRDTLLGPGRPYRAIDFSHQGPAFVTWHRYH LLCLERDLQRLIGNESFALPYWNFATGRNECDVCTDQLFGAARPDDPTLI SRNSRFSSWETVCDSLDDYNHLVTLCNGTYEGLLRRNQMGRNSMKLPTLK DIRDCLSLQKFDNPPFFQNSTFSFRNALEGFDKADGTLDSQVMSLHNLVH SFLNGTNALPHSAANDPIFVVLHSFTDAIFDEWMKRFNPPADAWPQELAP IGHNRMYNMVPFFPPVTNEELFLTSDQLGYSYAIDLPVSVEETPGWPTTH HHHHH
    • Predicted molecular weight

      52 kDa including tags
    • Amino acids

      24 to 472
    • Tags

      His tag C-Terminus
    • Additional sequence information

      Lumenal, melanosome domain (NP_001913).

Specifications

Our Abpromise guarantee covers the use of ab222949 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

  • Form

    Liquid
  • Additional notes

    Previously labelled as TRP2

  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    pH: 7.40
    Constituents: 10% Glycerol, PBS

General Info

  • Alternative names

    • L dopachrome tautomerase
    • DCT
    • Dopachrome delta isomerase
    • Dopachrome tautomerase
    • Dopachrome tautomerase dopachrome delta isomerase, tyrosine related protein 2
    • DT
    • EC 5.3.3.12
    • L dopachrome Delta isomerase
    • L-dopachrome Delta-isomerase
    • L-dopachrome tautomerase
    • TRP 2
    • TRP-2
    • TRP2
    • Tyrosinase related protein 2
    • Tyrosinase-related protein 2
    • TYRP2
    • TYRP2_HUMAN
    see all
  • Function

    Involved in regulating eumelanin and phaeomelanin levels.
  • Pathway

    Pigment biosynthesis; melanin biosynthesis.
  • Sequence similarities

    Belongs to the tyrosinase family.
  • Cellular localization

    Melanosome membrane.
  • Information by UniProt

Images

  • 15% SDS-PAGE analysis of 3 µg ab222949.

    MWt 50-70 kDa (SDS-PAGE under reducing conditions).

References

ab222949 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab222949.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up