Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      VANEESEHNQASIVFPPPGASEENGLPHTSARTQLPQSMKIMHEIMYKLE VLYVLCVLLMGRQRNQVHRMIAEFKLIPGLNNLFDKLIWRKHSASALVLH GHNQNCDCSPD
    • Amino acids
      341 to 451
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab161905 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • C20orf188
    • TRPC4AP
    • Chromosome 20 open reading frame 188
    • Protein TAP1
    • Protein TRUSS
    • Short transient receptor potential channel 4 associated protein
    • Short transient receptor potential channel 4-associated protein
    • TAP1 protein
    • TNF receptor ubiquitous scaffolding/signaling protein
    • TNF-receptor ubiquitous scaffolding/signaling protein
    • TP4AP_HUMAN
    • Transient receptor potential cation channel, subfamily C, member 4 associated protein
    • Trp4 associated protein
    • Trp4-associated protein
    • Trpc4 associated protein
    • Trpc4-associated protein
    • TRPC4AP
    • TRRP4AP
    • TRUSS
    • Tumor necrosis factor receptor-associated ubiquitous scaffolding and signaling protein
    see all
  • Function
    Substrate-specific adapter of a DCX (DDB1-CUL4-X-box) E3 ubiquitin-protein ligase complex required for cell cycle control. The DCX(TRUSS) complex specifically mediates the polyubiquitination and subsequent degradation of MYC. Also participates in the activation of NFKB1 in response to ligation of TNFRSF1A, possibly by linking TNFRSF1A to the IKK signalosome. Involved in JNK activation via its interaction with TRAF2. Also involved in elevation of endoplasmic reticulum Ca(2+) storage reduction in response to CHRM1.
  • Pathway
    Protein modification; protein ubiquitination.
  • Information by UniProt

Images

  • ab161905 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab161905 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab161905.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up