Recombinant Human TRPM7 protein (ab153385)
Key features and details
- Expression system: Wheat germ
- Tags: GST tag N-Terminus
- Suitable for: WB, ELISA
Description
-
Product name
Recombinant Human TRPM7 protein -
Expression system
Wheat germ -
Protein length
Protein fragment -
Animal free
No -
Nature
Recombinant -
-
Species
Human -
Sequence
KTKAEMSHIPQSQDAHQMTMDDSENNFQNITEEIPMEVFKEVRILDSNEG KNEMEIQMKSKKLPITRKFYAFYHAPIVK -
Amino acids
777 to 855 -
Tags
GST tag N-Terminus
-
Specifications
Our Abpromise guarantee covers the use of ab153385 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
-
Applications
Western blot
ELISA
-
Form
Liquid -
Additional notes
-
Concentration information loading...
Preparation and Storage
-
Stability and Storage
Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.
pH: 8.00
Constituents: 0.31% Glutathione, 0.79% Tris HCl
General Info
-
Alternative names
- ALSPDC
- CHAK
- CHAK1
see all -
Function
Essential ion channel and serine/threonine-protein kinase. Divalent cation channel permeable to calcium and magnesium. Has a central role in magnesium ion homeostasis and in the regulation of anoxic neuronal cell death. The kinase activity is essential for the channel function. May be involved in a fundamental process that adjusts plasma membrane divalent cation fluxes according to the metabolic state of the cell. Phosphorylates annexin A1 (ANXA1). -
Involvement in disease
Defects in TRPM7 are a cause of susceptibility to amyotrophic lateral sclerosis-parkinsonism/dementia complex type 1 (ALS-PDC1) [MIM:105500]; also called amyotrophic lateral sclerosis-parkinsonism/dementia complex of Guam or Guam disease. Amyotrophic lateral sclerosis-parkinsonism/dementia complex type 1 is a neurodegenerative disorder characterized by chronic, progressive and uniformly fatal amyotrophic lateral sclerosis and parkinsonism-dementia. Both diseases are known to occur in the same kindred, the same sibship and even the same individual. -
Sequence similarities
In the C-terminal section; belongs to the protein kinase superfamily. Alpha-type protein kinase family. ALPK subfamily.
In the N-terminal section; belongs to the transient receptor (TC 1.A.4) family. LTrpC subfamily. TRPM7 sub-subfamily.
Contains 1 alpha-type protein kinase domain. -
Post-translational
modificationsAutophosphorylated. -
Cellular localization
Membrane. - Information by UniProt
Images
-
SDS-PAGE - Recombinant Human TRPM7 protein (ab153385)ab153385 on a 12.5% SDS-PAGE stained with Coomassie Blue.
Protocols
To our knowledge, customised protocols are not required for this product. Please try the standard protocols listed below and let us know how you get on.
Datasheets and documents
References (0)
ab153385 has not yet been referenced specifically in any publications.
