Recombinant Human TRPML1 protein (ab153445)

Overview

  • Product name
    Recombinant Human TRPML1 protein
  • Protein length
    Full length protein

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MTAPAGPRGSETERLLTPNPGYGTQAGPSPAPPTPPEEEDLRRRLKYFFM SPCDKFRAKGRKPCKLMLQVVKILVVTVQLILFGLSNQLAVTFREENTIA FRHLFLLGYSDGADDTFAAYTREQLYQAIFHAVDQYLALPDVSLGRYAYV RGGGDPWTNGSGLALCQRYYHRGHVDPANDTFDIDPMVVTDCIQVDPPER PPPPPSDDLTLLESSSSYKNLTLKFHKLVNVTIHFRLKTINLQSLINNEI PDCYTFSVLITFDNKAHSGRIPISLETQAHIQECKHPSVFQHGDNSFRLL FDVVVILTCSLSFLLCARSLLRGFLLQNEFVGFMWRQRGRVISLWERLEF VNGWYILLVTSDVLTISGTIMKIGIEAKNLASYDVCSILLGTSTLLVWVG VIRYLTFFHNYNILIATLRVALPSVMRFCCCVAVIYLGYCFCGWIVLGPY HVKFRSLSMVSECLFSLINGDDMFVTFAAMQAQQGRSSLVWLFSQLYLYS FISLFIYMVLSLFIALITGAYDTIKHPGGAGAEESELQAYIAQCQDSPTS GKFRRGSGSACSLLCCCGRDPSEEHSLLVN
    • Amino acids
      1 to 580
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab153445 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • MCLN1_HUMAN
    • Mcoln 1
    • Mcoln1
    • MG 2
    • MG-2
    • MG2
    • ML 4
    • ML4
    • MLIV
    • MST080
    • MSTP080
    • Mucolipidin
    • Mucolipin 1
    • Mucolipin-1
    • Mucolipin1
    • TRP ML1
    • TRPML1
    see all
  • Function
    Cation channel probably playing a role in the endocytic pathway and in the control of membrane trafficking of proteins and lipids. Could play a major role in Ca(2+) transport regulating lysosomal exocytosis.
  • Tissue specificity
    Widely expressed in adult and fetal tissues.
  • Involvement in disease
    Mucolipidosis 4
  • Sequence similarities
    Belongs to the transient receptor (TC 1.A.4) family. Polycystin subfamily. MCOLN1 sub-subfamily.
  • Cellular localization
    Cell membrane. Late endosome membrane. Lysosome membrane.
  • Information by UniProt

Images

  • ab153445 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab153445 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab153445.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up