Description

  • Product name

    Recombinant Human TRRAP protein
  • Expression system

    Wheat germ
  • Protein length

    Protein fragment
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      KNVLSVMFRFLETENEENVLICLRIIIELHKQFRPPITQEIHHFLDFVKQ IYKELPKVVNRYFENPQVIPENTVPPPEMVGMITTIAVKVNPEREDSETR THSIIPRGSL
    • Amino acids

      111 to 220
    • Tags

      GST tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab159983 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form

    Liquid
  • Additional notes

    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names

    • 350/400 kDa PCAF associated factor
    • PAF 350/400
    • PAF 400
    • PAF350/400
    • PAF400
    • STAF 40
    • STAF40
    • TR AP
    • Tra 1
    • Tra1
    • Tra1 homolog
    • Transactivation / transformation domain associated protein
    • Transactivation/transformation domain associated protein
    • Transformation/transcription domain associated protein
    • TRAP
    see all
  • Relevance

    TRRAP (TRansformation/tRanscription domain Associated Protein) is an adapter protein that is found in a number of multiprotein chromatin complexes with histone acetyltransferase (HAT) activity. These complexes include PCAF, TFTC-HAT, TIP60 HAT, STAGA, and BAF53 complexes. TRRAP is thought to be responsible for the concerted and context-dependent recruitment of these complexes to chromatin during transcription, replication and DNA repair. TRRAP plays a key role in transcriptional activation by c-Myc, p53/TP53, E2F1 and E2F4.
  • Cellular localization

    Nuclear

Images

  • ab159983 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab159983 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab159983.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up