Recombinant human Tryptophan Hydroxylase/TPH protein (Active) (ab206448)

Description

  • Product name

    Recombinant human Tryptophan Hydroxylase/TPH protein (Active)
  • Biological activity

    Assay Conditions: Reaction was performed at room temperature in assay buffer containing 50 mM MOPS, pH 7.0, 60 μM tryptophan, 100 mM ammonium sulfate, 100 μM ferrous ammonium sulfate, 0.5 mM TCEP, 0.3 mM 6-methyl tetrahydropterin, 0.05 mg/ml catalase, 1 mM DTT and TPH1. Fluorescence signal was measured at Em360nm/Ex300nm.

  • Purity

    > 90 % SDS-PAGE.

  • Expression system

    Escherichia coli
  • Accession

  • Protein length

    Protein fragment
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      VPWFPKKISDLDHCANRVLMYGSELDADHPGFKDNVYRKRRKYFADLAMN YKHGDPIPKVEFTEEEIKTWGTVFQELNKLYPTHACREYLKNLPLLSKYC GYREDNIPQLEDVSNFLKERTGFSIRPVAGYLSPRDFLSGLAFRVFHCTQ YVRHSSDPFYTPEPDTCHELLGHVPLLAEPSFAQFSQEIGLASLGASEEA VQKLATCYFFTVEFGLCKQDGQLRVFGAGLLSSISELKHALSGHAKVKPF DPKITCKQECLITTFQDVYFVSESFEDAKEKMREFTKTIKRPFGVKYNPY TRSIQILKDTKSITSA
    • Predicted molecular weight

      37 kDa including tags
    • Amino acids

      105 to 420
    • Tags

      His tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab206448 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    Functional Studies

  • Form

    Liquid
  • Additional notes

     This product was previously labelled as Tryptophan Hydroxylase

     

  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on Dry Ice. Store at -80°C. Avoid freeze / thaw cycle.

    pH: 8.0
    Preservative: 1.16% Imidazole
    Constituents: 0.63% Tris HCl, 0.64% Sodium chloride, 0.02% Potassium chloride, 0.04% Tween, 20% Glycerol, 0.05% DTT

    Storing diluted enzyme is not recommended, if necessary, use carrier protein (BSA 0.1 – 0.5%).

    This product is an active protein and may elicit a biological response in vivo, handle with caution.

General Info

  • Alternative names

    • Indoleacetic acid 5 hydroxylase
    • L tryptophan hydroxylase
    • MGC119994
    • TPH
    • TPH 1
    • TPH1
    • TPH1_HUMAN
    • TPRH
    • TRPH
    • Tryptophan 5 hydroxylase 1
    • Tryptophan 5 monooxygenase
    • Tryptophan 5 monooxygenase 1
    • Tryptophan 5-hydroxylase 1
    • Tryptophan 5-monooxygenase 1
    • Tryptophan hydroxylase 1
    see all
  • Tissue specificity

    Isoform 2 seems to be less widely expressed than isoform 1.
  • Pathway

    Aromatic compound metabolism; serotonin biosynthesis; serotonin from L-tryptophan: step 1/2.
  • Sequence similarities

    Belongs to the biopterin-dependent aromatic amino acid hydroxylase family.
    Contains 1 ACT domain.
  • Information by UniProt

Images

  • Activity assay using ab206448

  • 6-20% SDS-PAGE stained with Coomassie Blue.
    Lane 1: ab206448 (5 µg)
    Lane 2: Protein Marker

References

ab206448 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab206448.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up