Description

  • Product name

    Recombinant Human Tryptophanyl tRNA synthetase/WRS protein
    See all Tryptophanyl tRNA synthetase/WRS proteins and peptides
  • Purity

    > 90 % SDS-PAGE.
    ab99263 is purified using conventional chromatography techniques.
  • Expression system

    Escherichia coli
  • Accession

  • Protein length

    Full length protein
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      MGSSHHHHHHSSGLVPRGSHMPNSEPASLLELFNSIATQGELVRSLKAGN ASKDEIDSAVKMLVSLKMSYKAAAGEDYKADCPPGNPAPTSNHGPDATEA EEDFVDPWTVQTSSAKGIDYDKLIVRFGSSKIDKELINRIERATGQRPHH FLRRGIFFSHRDMNQVLDAYENKKPFYLYTGRGPSSEAMHVGHLIPFIFT KWLQDVFNVPLVIQMTDDEKYLWKDLTLDQAYSYAVENAKDIIACGFDIN KTFIFSDLDYMGMSSGFYKNVVKIQKHVTFNQVKGIFGFTDSDCIGKISF PAIQAAPSFSNSFPQIFRDRTDIQCLIPCAIDQDPYFRMTRDVAPRIGYP KPALLHSTFFPALQGAQTKMSASDPNSSIFLTDTAKQIKTKVNKHAFSGG RDTIEEHRQFGGNCDVDVSFMYLTFFLEDDDKLEQIRKDYTSGAMLTGEL KKALIEVLQPLIAEHQARRKEVTDEIVKEFMTPRKLSFDFQ
    • Predicted molecular weight

      55 kDa including tags
    • Amino acids

      1 to 471
    • Tags

      His tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab99263 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    Mass Spectrometry

  • Mass spectrometry

    MALDI-TOF
  • Form

    Liquid
  • Additional notes

    Previously labelled as Tryptophanyl tRNA synthetase. 

  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Upon delivery aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.0154% DTT, 0.316% Tris HCl, 10% Glycerol, 0.58% Sodium chloride

General Info

  • Alternative names

    • Gamma 2
    • GAMMA-2
    • Gamma2
    • hWRS
    • IFI 53
    • IFI53
    • IFP 53
    • IFP53
    • Interferon induced protein 53
    • Interferon-induced protein 53
    • SYWC_HUMAN
    • T2-TrpRS
    • TrpRS
    • Tryptophan tRNA ligase, cytoplasmic
    • Tryptophan tRNA ligase
    • Tryptophan tRNA ligase 1 cytoplasmic
    • Tryptophan--tRNA ligase
    • Tryptophanyl tRNA synthetase
    • Tryptophanyl tRNA synthetase cytoplasmic
    • WARS
    • WARS protein
    • WRS
    see all
  • Function

    Isoform 1, isoform 2 and T1-TrpRS have aminoacylation activity while T2-TrpRS lacks it. Isoform 2, T1-TrpRS and T2-TrpRS possess angiostatic activity whereas isoform 1 lacks it. T2-TrpRS inhibits fluid shear stress-activated responses of endothelial cells. Regulates ERK, Akt, and eNOS activation pathways that are associated with angiogenesis, cytoskeletal reorganization and shear stress-responsive gene expression.
  • Sequence similarities

    Belongs to the class-I aminoacyl-tRNA synthetase family.
    Contains 1 WHEP-TRS domain.
  • Post-translational
    modifications

    Proteolytic cleavage generates 2 forms; T1-TrpRS and T2-TrpRS.
  • Cellular localization

    Cytoplasm.
  • Information by UniProt

Images

  • 15% SDS-PAGE showing ab99263 (3µg).

References

ab99263 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab99263.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up