Recombinant Human TSC-1 protein (ab218086)
Key features and details
- Expression system: Escherichia coli
- Purity: = 97% SDS-PAGE
- Endotoxin level: < 0.050 Eu/µg
- Suitable for: SDS-PAGE
Description
-
Product name
Recombinant Human TSC-1 protein
See all TSC-1 proteins and peptides -
Purity
= 97 % SDS-PAGE.
The purity of ab218086 is determined by Reducing and Non-reducing SDS-PAGE. -
Endotoxin level
< 0.050 Eu/µg -
Expression system
Escherichia coli -
Accession
-
Protein length
Full length protein -
Animal free
No -
Nature
Recombinant -
-
Species
Human -
Sequence
TRGSDISKTCCFQYSHKPLPWTWVRSYEFTSNSCSQRAVIFTTKRGKKVC THPRKKWVQKYISLLKTPKQL -
Predicted molecular weight
8 kDa -
Amino acids
24 to 94 -
Additional sequence information
This product is the mature full length protein from aa 24 to 94. The signal peptide is not included. Non-glycosylated protein.
-
Associated products
-
Related Products
Specifications
Our Abpromise guarantee covers the use of ab218086 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
-
Applications
SDS-PAGE
-
Form
Lyophilized -
Additional notes
Previously labelled as Eotaxin 3.
-
Concentration information loading...
Preparation and Storage
-
Stability and Storage
Shipped at 4°C. Store at -20°C. Avoid freeze / thaw cycle.
Constituent: 0.1% Trifluoroacetic acid
Lyophilised from a sterile filtered solution. -
ReconstitutionReconstitute in sterile water at 0.1 mg/ml. Suspend the product by gently pipetting the above recommended solution down the sides of the vial. DO NOT VORTEX. Allow several minutes for complete reconstitution. For prolonged storage, dilute to working aliquots in a 0.1% BSA solution, store at -80 ºC and avoid repeat freeze thaws.
General Info
-
Alternative names
- C-C motif chemokine 26
- CC chemokine IMAC
- CCL 26
see all -
Function
Chemotactic for eosinophils and basophils. Binds to CCR3. -
Tissue specificity
Ubiquitously expressed at low levels in various tissues including heart and ovary. -
Sequence similarities
Belongs to the intercrine beta (chemokine CC) family. -
Cellular localization
Secreted. - Information by UniProt
Protocols
To our knowledge, customised protocols are not required for this product. Please try the standard protocols listed below and let us know how you get on.
Datasheets and documents
-
SDS download
-
Datasheet download
References (0)
ab218086 has not yet been referenced specifically in any publications.