Overview

Description

  • Nature

    Recombinant
  • Source

    Escherichia coli
  • Amino Acid Sequence
    • Accession
    • Species

      Human
    • Sequence

      TRGSDISKTCCFQYSHKPLPWTWVRSYEFTSNSCSQRAVIFTTKRGKKVC THPRKKWVQKYISLLKTPKQL
    • Molecular weight

      8 kDa
    • Amino acids

      24 to 94
    • Additional sequence information

      This product is the mature full length protein from aa 24 to 94. The signal peptide is not included. Non-glycosylated protein.

Specifications

Our Abpromise guarantee covers the use of ab218086 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

  • Endotoxin level

    < 0.050 Eu/µg
  • Purity

    = 97 % SDS-PAGE.
    The purity of ab218086 is determined by Reducing and Non-reducing SDS-PAGE.
  • Form

    Lyophilised
  • Additional notes

    Previously labelled as Eotaxin 3. 

  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at -20°C. Avoid freeze / thaw cycle.

    Constituent: 0.1% Trifluoroacetic acid

    Lyophilised from a sterile filtered solution.

  • Reconstitution
    Reconstitute in sterile water at 0.1 mg/ml. Suspend the product by gently pipetting the above recommended solution down the sides of the vial. DO NOT VORTEX. Allow several minutes for complete reconstitution. For prolonged storage, dilute to working aliquots in a 0.1% BSA solution, store at -80 ºC and avoid repeat freeze thaws.

General Info

  • Alternative names

    • C-C motif chemokine 26
    • CC chemokine IMAC
    • CCL 26
    • CCL26
    • CCL26_HUMAN
    • Chemokine (C C motif) ligand 26
    • chemokine N1
    • Eotaxin 3
    • Eotaxin-3
    • IMAC
    • Macrophage inflammatory protein 4-alpha
    • MIP 4a
    • MIP 4alpha
    • MIP-4-alpha
    • MIP4a
    • MIP4alpha
    • SCYA 26
    • SCYA26
    • Small inducible cytokine A26
    • Small inducible cytokine subfamily A (Cys Cys) member 26
    • Small inducible cytokine subfamily A member 26
    • Small-inducible cytokine A26
    • Thymic stroma chemokine 1
    • Thymic stroma chemokine-1
    • TSC 1
    • TSC-1
    • TSC1
    see all
  • Function

    Chemotactic for eosinophils and basophils. Binds to CCR3.
  • Tissue specificity

    Ubiquitously expressed at low levels in various tissues including heart and ovary.
  • Sequence similarities

    Belongs to the intercrine beta (chemokine CC) family.
  • Cellular localization

    Secreted.
  • Information by UniProt

References

ab218086 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab218086.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up