Recombinant human TSC-1 protein (Active) (ab243255)
Key features and details
- Expression system: Escherichia coli
- Purity: > 97% SDS-PAGE
- Endotoxin level: < 1.000 Eu/µg
- Active: Yes
- Suitable for: Functional Studies, HPLC, SDS-PAGE
Description
-
Product name
Recombinant human TSC-1 protein (Active)
See all TSC-1 proteins and peptides -
Biological activity
Fully biologically active when compared to standard. The biological activity determined by a chemotaxis bioassay using human CCR3 transfected HEK-293 cells is in a concentration range of 0.5 - 2.0 μg/ml.
-
Purity
> 97 % SDS-PAGE.
> 97 % by HPLC -
Endotoxin level
< 1.000 Eu/µg -
Expression system
Escherichia coli -
Accession
-
Protein length
Full length protein -
Animal free
No -
Nature
Recombinant -
-
Species
Human -
Sequence
TRGSDISKTCCFQYSHKPLPWTWVRSYEFTSNSCSQRAVIFTTKRGKKVC THPRKKWVQKYISLLKTPKQL -
Predicted molecular weight
8 kDa -
Amino acids
24 to 94 -
Additional sequence information
Full-length mature chain lacking the signal peptide.
-
Associated products
-
Related Products
Specifications
Our Abpromise guarantee covers the use of ab243255 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
-
Applications
Functional Studies
HPLC
SDS-PAGE
-
Form
Lyophilized -
Concentration information loading...
Preparation and Storage
-
Stability and Storage
Shipped at 4°C. Store at -20°C or -80°C. Avoid freeze / thaw cycle.
Constituent: PBS
0.2 µm filteredThis product is an active protein and may elicit a biological response in vivo, handle with caution.
-
ReconstitutionBriefly centrifuge prior to opening to bring the contents to the bottom. Reconstitute in sterile distilled water or aqueous buffer containing 0.1 % BSA to a concentration of 0.1-1.0 mg/mL. Stock solutions should be apportioned into working aliquots and stored at -20 °C or below. Further dilutions should be made in appropriate buffered solutions.
General Info
-
Alternative names
- C-C motif chemokine 26
- CC chemokine IMAC
- CCL 26
see all -
Function
Chemotactic for eosinophils and basophils. Binds to CCR3. -
Tissue specificity
Ubiquitously expressed at low levels in various tissues including heart and ovary. -
Sequence similarities
Belongs to the intercrine beta (chemokine CC) family. -
Cellular localization
Secreted. - Information by UniProt
Protocols
To our knowledge, customised protocols are not required for this product. Please try the standard protocols listed below and let us know how you get on.
Datasheets and documents
References (0)
ab243255 has not yet been referenced specifically in any publications.