Overview

Description

  • Nature

    Recombinant
  • Source

    Wheat germ
  • Amino Acid Sequence
    • Accession
    • Species

      Human
    • Sequence

      MKSQWCRPVAMDLGVYQLRHFSISFLSSLLGTENASVRLDNSSSGASVVA IDNKIEQAMDLVKSHLMYAVREEVEVLKEQIKELIEKNSQLEQENNLLKT LASPEQLAQFQAQLQTGSPPATTQPQGTTQPPAQPASQGSGPTA
    • Molecular weight

      42 kDa including tags
    • Amino acids

      1 to 144

Specifications

Our Abpromise guarantee covers the use of ab132606 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    SDS-PAGE

    Western blot

  • Form

    Liquid
  • Additional notes

    Protein concentration is above or equal to 0.05 µg/µl.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names

    • Cerebral protein 2
    • DKFZp686O19206
    • Hucep 2
    • Hucep2
    • KIAA1994
    • MGC17597
    • OTTHUMP00000040978
    • Ptg 2
    • Regulatory protein TSC 22
    • Regulatory protein TSC-22
    • Regulatory protein TSC22
    • RP11 269C23.2
    • T22D1_HUMAN
    • TGFB stimulated clone 22 homolog
    • TGFB-stimulated clone 22 homolog
    • TGFB1I4
    • TGFbeta stimulated clone 22
    • Transcriptional regulator TSC 22
    • Transforming growth factor beta 1 induced transcript 4
    • Transforming growth factor beta 1 induced transcript 4 protein
    • Transforming growth factor beta stimulated protein TSC 22
    • Transforming growth factor beta-1-induced transcript 4 protein
    • TSC 22
    • TSC22
    • TSC22 domain family 1 isoform 2
    • TSC22 domain family member 1
    • TSC22 domain family protein 1
    • TSC22D1
    see all
  • Function

    Transcriptional repressor. Acts on the C-type natriuretic peptide (CNP) promoter.
  • Tissue specificity

    Widely expressed in fetal and adult tissues.
  • Sequence similarities

    Belongs to the TSC-22/Dip/Bun family.
  • Cellular localization

    Cytoplasm. Nucleus.
  • Information by UniProt

Images

  • 12.5% SDS-PAGE analysis of ab132606 stained with Coomassie Blue.

References

ab132606 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab132606.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up