Description

  • Product name

    Recombinant Human TSG6 protein (Tagged)
    See all TSG6 proteins and peptides
  • Expression system

    Wheat germ
  • Accession

  • Protein length

    Full length protein
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      MIILIYLFLLLWEDTQGWGFKDGIFHNSIWLERAAGVYHREARSGKYKLT YAEAKAVCEFEGGHLATYKQLEAARKIGFHVCAAGWMAKGRVGYPIVKPG PNCGFGKTGIIDYGIRLNRSERWDAYCYNPHAKECGGVFTDPKQIFKSPG FPNEYEDNQICYWHIRLKYGQRIHLSFLDFDLEDDPGCLADYVEIYDSYD DVHGFVGRYCGDELPDDIISTGNVMTLKFLSDASVTAGGFQIKYVAMDPV SKSSQGKNTSTTSTGNKNFLAGRFSHL
    • Predicted molecular weight

      58 kDa including tags
    • Amino acids

      1 to 277
    • Tags

      GST tag N-Terminus

Associated products

Specifications

Our Abpromise guarantee covers the use of ab132329 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    SDS-PAGE

    ELISA

  • Form

    Liquid
  • Additional notes

    Protein concentration is above or equal to 0.05 mg/ml.
    Best used within three months from the date of receipt.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names

    • Hyaluronate binding protein
    • Hyaluronate-binding protein
    • TNF alpha induced protein 6
    • TNF alpha-induced protein 6
    • TNF stimulated gene 6 protein
    • TNF-stimulated gene 6 protein
    • TNFAIP 6
    • Tnfaip6
    • TSG 6
    • TSG-6
    • TSG6_HUMAN
    • Tumor necrosis factor alpha induced protein 6
    • Tumor necrosis factor alpha inducible protein 6
    • Tumor necrosis factor alpha-induced protein 6
    • Tumor necrosis factor inducible gene 6 protein
    • Tumor necrosis factor stimulated gene 6 protein
    • Tumor necrosis factor-inducible gene 6 protein
    see all
  • Function

    Possibly involved in cell-cell and cell-matrix interactions during inflammation and tumorigenesis.
  • Tissue specificity

    Found in the synovial fluid of patients with rheumatoid arthritis.
  • Sequence similarities

    Contains 1 CUB domain.
    Contains 1 Link domain.
  • Information by UniProt

Images

  • 12.5% SDS-PAGE analysis of ab132329 stained with Coomassie Blue.

References

ab132329 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab132329.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up