Description

  • Product name

    Recombinant Human TSGA10 protein
  • Expression system

    Wheat germ
  • Protein length

    Full length protein
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      MMRSRSKSPRRPSPTARGANCDVELLKTTTRDREELKCMLEKYERHLAEI QGNVKVLKSERDKIFLLYEQAQEEITRLRREMMKSCKSPKSTTAHAILRR VETERDVAFTDLRRMTTERDSLRERLKIAQETAFNEKAHLEQRIEELECT VHNLDDERMEQMSNMTLMKETISTVEKEMKSLARKAMDTESELGRQKAEN NSLRLLYENTEKDLSDTQRHLAKKKYELQLTQEKIMCLDEKIDNFTRQNI AQREEISILGGTLNDLAKEKECMQACLDKKSENIASLGESLAMKEKTISG MKNIIAEMEQASRQCTEALIVCEQDVSRMRRQLDETNDELAQIARERDIL AHDNDNLQEQFAKAKQENQALSKKLNDTHNELNDIKQKVQDTNLEVNKLK NILKSEESENRQMMEQLRKANEDAENWENKARQSEADNNTLKLELITAEA EGNRLKEKVDSLNREVEQHLNAERSYKSQISTLHKSVVKMEEELQKVQFE KVSALADLSSTRELCIKLDSSKELLNRQLVAKDQEIEMRENELDSAHSEI ELLRSQMANERISMQNLEALLVANRDKEYQSQIALQEKESEIQLLKEHLC LAENKMAIQSRDVAQFRNVVTQLEADLDITKRQLGTERFERERAVQELRR QNYSSNAYHMSSTMKPNTKCHSPERAHHRSPDRGLDRSLEENLCYRDF
    • Amino acids

      1 to 698
    • Tags

      GST tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab164276 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form

    Liquid
  • Additional notes

    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names

    • Cancer/testis antigen 79
    • CEP4L
    • CT79
    • Predicted testis protein
    • Testis development protein NYD-SP7
    • Testis-specific gene 10 protein
    • Testis-specific protein 10
    • TSG10_HUMAN
    • Tsga10
    see all
  • Function

    May play a role in the sperm tail fibrous sheath, a major sperm tail structure.
  • Tissue specificity

    Testis specific.
  • Sequence similarities

    Belongs to the CEP135/TSGA10 family.
  • Post-translational
    modifications

    Appears to be processed in a 27 kDa and a 55 kDa peptide containing respectively the N-terminal and the C-terminal part of the precursor.
  • Cellular localization

    Cytoplasm. Nucleus. Nucleus membrane. The 27 kDa peptide associates with the fibrous sheath in mature spermatozoa and localizes to the principal piece of sperm tail while the 55 kDa peptide localizes to the midpiece.
  • Information by UniProt

Images

  • ab164276 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab164276 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab164276.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up