Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      LCLAENKMAIQSRDVAQFRNVVTQLEADLDITKRQLGTERFERERAVQEL RRQNYSSNAYHMSSTMKPNTKCHSPERAHHRSPDRGLDRSLEENLCYRDF
    • Amino acids
      599 to 698
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab164277 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • Cancer/testis antigen 79
    • CEP4L
    • CT79
    • Predicted testis protein
    • Testis development protein NYD-SP7
    • Testis-specific gene 10 protein
    • Testis-specific protein 10
    • TSG10_HUMAN
    • Tsga10
    see all
  • Function
    May play a role in the sperm tail fibrous sheath, a major sperm tail structure.
  • Tissue specificity
    Testis specific.
  • Sequence similarities
    Belongs to the CEP135/TSGA10 family.
  • Post-translational
    modifications
    Appears to be processed in a 27 kDa and a 55 kDa peptide containing respectively the N-terminal and the C-terminal part of the precursor.
  • Cellular localization
    Cytoplasm. Nucleus. Nucleus membrane. The 27 kDa peptide associates with the fibrous sheath in mature spermatozoa and localizes to the principal piece of sperm tail while the 55 kDa peptide localizes to the midpiece.
  • Information by UniProt

Images

  • ab164277 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab164277 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab164277.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up