Description

  • Product name

    Recombinant Human TSKS protein
  • Expression system

    Wheat germ
  • Protein length

    Full length protein
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      MASVVVKTIWQSKEIHEAGDTPTGVESCSQLVPEAPRRVTSRAKGIPKKK KAVSFHGVEPQMSHQPMHWCLNLKRSSACTNVSLLNLAAMEPTDSTGTDS TVEDLSGQLTLAGPPASPTLPWDPDDADITEILSGVNSGLVRAKDSITSL KEKTNRVNQHVQSLQSECSVLSENLERRRQEAEELEGYCIQLKENCWKVT RSVEDAEIKTNVLKQNSALLEEKLRYLQQQLQDETPRRQEAELQEPEEKQ EPEEKQEPEEKQKPEAGLSWNSLGPAATSQGCPGPPGSPDKPSRPHGLVP AGWGMGPRAGEGPYVSEQELQKLFTGIEELRREVSSLTARWHQEEGAVQE ALRLLGGLGGRVDGFLGQWERAQREQAQTARDLQELRGRADELCTMVERS AVSVASLRSELEGLGPLKPILEEFGRQFQNSRRGPDLSMNLDRSHQGNCA RCASQGSQLSTESLQQLLDRALTSLVDEVKQRGLTPACPSCQRLHKKILE LERQALAKHVRAEALSSTLRLAQDEALRAKNLLLTDKMKPEEKMATLDHL HLKMCSLHDHLSNLPLEGSTGTMGGGSSAGTPPKQGGSA
    • Amino acids

      1 to 589
    • Tags

      GST tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab163712 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form

    Liquid
  • Additional notes

    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names

    • MGC134104
    • STK22 substrate 1
    • Stk22s1
    • Testis specific kinase substrate
    • Testis specific serine kinase substrate
    • Testis specific serine/threonine kinase substrate
    • Testis-specific kinase substrate
    • Testis-specific serine kinase substrate
    • TSKS
    • TSKS_HUMAN
    • TSKS1
    • TSSKS
    see all
  • Function

    May play a role in testicular physiology, most probably in the process of spermatogenesis or spermatid development.
  • Tissue specificity

    Highly expressed in testis. Expressed at low levels in prostate, female breast, placenta, ovary and thymus.
  • Post-translational
    modifications

    Phosphorylated on serine residue(s) by STK22A/TSSK1 and STK22B/TSSK2.
  • Cellular localization

    Cytoplasm > cytoskeleton > centrosome > centriole. Concentrates in spermatid centrioles during flagellogenesis.
  • Information by UniProt

Images

  • ab163712 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab163712 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab163712.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up