Description

  • Product name

    Recombinant human TSLP protein
    See all TSLP proteins and peptides
  • Biological activity

    Fully biologically active when compared to standard.

    The ED50 as measured by its ability to induce proliferation of Human IL-7Rα and Human TSLP R co-transfected mouse BaF3 cells is less than 0.3 ng/ml.

  • Purity

    > 98 % SDS-PAGE.
    > 98 % by HPLC analysis.
  • Endotoxin level

    < 1.000 Eu/µg
  • Expression system

    Escherichia coli
  • Accession

  • Protein length

    Full length protein
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      MYDFTNCDFEKIKAAYLSTISKDLITYMSGTKSTEFNNTVSCSNRPHCLT EIQSLTFNPTAGCASLAKEMFAMKTKAALAIWCPGYSETQINATQAMKKR RKRKVTTNKCLEQVSQLQGLWRRFNRPLLKQQ
    • Predicted molecular weight

      15 kDa
    • Amino acids

      29 to 159
    • Additional sequence information

      Single non-glycosylated polypeptide chain containing 132 amino acids. This product is the mature full length protein from aa 29 to 159. The signal peptide is not included.

Associated products

Specifications

Our Abpromise guarantee covers the use of ab201363 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Functional Studies

    HPLC

    SDS-PAGE

  • Form

    Lyophilised
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at -20°C long term. Avoid freeze / thaw cycle.

    pH: 7.40
    Constituents: 0.87% Sodium chloride, 99% Phosphate Buffer

    Lyophilized from a 0.2µm filtered solution.

    This product is an active protein and may elicit a biological response in vivo, handle with caution.

  • Reconstitution
    Briefly centrifuge the vial prior to opening to bring the contents to the bottom. Reconstitute in sterile distilled water or aqueous buffer containing 0.1% BSA to a concentration of 0.1-1.0 mg/mL. Stock solutions should be apportioned into working aliquots and stored at <-20°C. Further dilutions should be made in appropriate buffered solutions.

General Info

  • Alternative names

    • Thymic stromal lymphopoietin
    • Thymic stromal lymphopoietin protein TSLP
    • Tslp
    • TSLP protein
    • TSLP_HUMAN
    see all
  • Function

    Cytokine that induces the release of T cell-attracting chemokines from monocytes and, in particular, enhances the maturation of CD11c(+) dendritic cells. Can induce allergic inflammation by directly activating mast cells.
  • Tissue specificity

    Expressed in a number of tissues including heart, liver and prostate.
  • Cellular localization

    Secreted.
  • Information by UniProt

References

This product has been referenced in:

  • Wei Y  et al. Excessive periostin expression and Th2 response in patients with nasal polyps: association with asthma. J Thorac Dis 10:6585-6597 (2018). Read more (PubMed: 30746204) »
See 1 Publication for this product

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab201363.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up